Recombinant Human Aurora A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Aurora A Peptides and Proteins

Order Details


    • Catalog Number
      H00006790-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Aurora A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human AURKA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AURKA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Aurora A Protein

  • AIK
  • AIKAurA
  • ARK1
  • ARK-1
  • ARK1EC 2.7.11.1
  • AURA
  • AURKA
  • Aurora A
  • aurora kinase AhARK1
  • aurora/IPL1-like kinase
  • Aurora/IPL1-related kinase 1
  • Aurora-related kinase 1
  • Breast tumor-amplified kinase
  • breast-tumor-amplified kinase
  • BTAK
  • BTAKAURORA2
  • EC 2.7.11
  • IPL1-related kinase
  • serine/threonine kinase 6
  • serine/threonine protein kinase 15
  • Serine/threonine-protein kinase 15
  • serine/threonine-protein kinase 6
  • Serine/threonine-protein kinase aurora-A
  • STK15
  • STK15serine/threonine kinase 15
  • STK6
  • STK6MGC34538
  • STK7

Background

STK6 - serine/threonine kinase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00004854-M01
Species: Hu
Applications: WB, ELISA
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
H00006790-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for Aurora A Partial Recombinant Protein (H00006790-Q02) (0)

There are no publications for Aurora A Partial Recombinant Protein (H00006790-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aurora A Partial Recombinant Protein (H00006790-Q02) (0)

There are no reviews for Aurora A Partial Recombinant Protein (H00006790-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aurora A Partial Recombinant Protein (H00006790-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aurora A Products

Bioinformatics Tool for Aurora A Partial Recombinant Protein (H00006790-Q02)

Discover related pathways, diseases and genes to Aurora A Partial Recombinant Protein (H00006790-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aurora A Partial Recombinant Protein (H00006790-Q02)

Discover more about diseases related to Aurora A Partial Recombinant Protein (H00006790-Q02).
 

Pathways for Aurora A Partial Recombinant Protein (H00006790-Q02)

View related products by pathway.

PTMs for Aurora A Partial Recombinant Protein (H00006790-Q02)

Learn more about PTMs related to Aurora A Partial Recombinant Protein (H00006790-Q02).
 

Research Areas for Aurora A Partial Recombinant Protein (H00006790-Q02)

Find related products by research area.

Blogs on Aurora A

There are no specific blogs for Aurora A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Aurora A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AURKA
Entrez