AUH Antibody

Images

 
Western Blot: AUH Antibody [NBP1-68920] - Mouse Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AUH Antibody Summary

Immunogen
Synthetic peptides corresponding to Auh (AU RNA binding protein/enoyl-coenzyme A hydratase) The peptide sequence was selected from the N terminal of Auh. Peptide sequence PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AUH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Auh and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AUH Antibody

  • 3-methylglutaconyl-CoA hydratase
  • AU RNA binding protein/enoyl-CoA hydratase
  • AU RNA binding protein/enoyl-Coenzyme A hydratase
  • AU RNA-binding protein/enoyl-Coenzyme A hydratase
  • AU-binding protein/enoyl-CoA hydratase
  • AU-specific RNA-binding enoyl-CoA hydratase
  • EC 4.2.1.18
  • methylglutaconyl-CoA hydratase, mitochondrial

Background

Auh Catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA. Auh has very low enoyl-CoA hydratase activity. Was originally identified as RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP2-15447
Species: Hu
Applications: WB
NBP2-15447
Species: Hu
Applications: WB
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-68920
Species: Mu
Applications: WB

Publications for AUH Antibody (NBP1-68920) (0)

There are no publications for AUH Antibody (NBP1-68920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AUH Antibody (NBP1-68920) (0)

There are no reviews for AUH Antibody (NBP1-68920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AUH Antibody (NBP1-68920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AUH Products

Bioinformatics Tool for AUH Antibody (NBP1-68920)

Discover related pathways, diseases and genes to AUH Antibody (NBP1-68920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AUH Antibody (NBP1-68920)

Discover more about diseases related to AUH Antibody (NBP1-68920).
 

Pathways for AUH Antibody (NBP1-68920)

View related products by pathway.

PTMs for AUH Antibody (NBP1-68920)

Learn more about PTMs related to AUH Antibody (NBP1-68920).

Blogs on AUH

There are no specific blogs for AUH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AUH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AUH
Uniprot