ATRX Recombinant Protein Antigen

Images

 
There are currently no images for ATRX Recombinant Protein Antigen (NBP2-52938PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATRX Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATRX.

Source: E. coli

Amino Acid Sequence: AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATRX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52938.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATRX Recombinant Protein Antigen

  • alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog)
  • alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae)
  • alpha thalassemia/mental retardation syndrome X-linked
  • ATP-dependent helicase ATRX
  • ATR2
  • DNA dependent ATPase and helicase
  • EC 3.6.1
  • EC 3.6.4.12
  • helicase 2, X-linked
  • Juberg-Marsidi syndrome
  • MGC2094
  • MRXHF1
  • RAD54 homolog
  • RAD54L
  • SFM1
  • SHS
  • transcriptional regulator ATRX
  • XH2RAD54
  • X-linked helicase II
  • X-linked nuclear protein
  • XNPZNF-HX
  • Zinc finger helicase
  • Znf-HX

Background

ATRX is encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NB100-2594
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83417
Species: Hu
Applications: IHC,  IHC-P
H00001487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, In vitro, KD, WB
NB100-214
Species: Hu, Mu
Applications: IP, WB
NBP2-04611
Species: Hu
Applications: WB
DY1707
Species: Hu
Applications: ELISA
MAB2476
Species: Hu
Applications: IHC, WB
NB100-56136
Species: Hu, Mu, Rt
Applications: IB, IHC,  IHC-P, IP, WB
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-52938PEP
Species: Hu
Applications: AC

Publications for ATRX Recombinant Protein Antigen (NBP2-52938PEP) (0)

There are no publications for ATRX Recombinant Protein Antigen (NBP2-52938PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATRX Recombinant Protein Antigen (NBP2-52938PEP) (0)

There are no reviews for ATRX Recombinant Protein Antigen (NBP2-52938PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATRX Recombinant Protein Antigen (NBP2-52938PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATRX Products

Research Areas for ATRX Recombinant Protein Antigen (NBP2-52938PEP)

Find related products by research area.

Blogs on ATRX

There are no specific blogs for ATRX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATRX Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATRX