ATRX Antibody (5B3)

Images

 
Immunocytochemistry/ Immunofluorescence: ATRX Antibody (5B3) [H00000546-M03] - Analysis of monoclonal antibody to ATRX on HeLa cell. Antibody concentration 20 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATRX Antibody (5B3) Summary

Immunogen
ATRX (NP_000480, 2311 a.a. - 2410 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILM
Specificity
ATRX - alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) (5B3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATRX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATRX Antibody (5B3)

  • alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog)
  • alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae)
  • alpha thalassemia/mental retardation syndrome X-linked
  • ATP-dependent helicase ATRX
  • ATR2
  • DNA dependent ATPase and helicase
  • EC 3.6.1
  • EC 3.6.4.12
  • helicase 2, X-linked
  • Juberg-Marsidi syndrome
  • MGC2094
  • MRXHF1
  • RAD54 homolog
  • RAD54L
  • SFM1
  • SHS
  • transcriptional regulator ATRX
  • XH2RAD54
  • X-linked helicase II
  • X-linked nuclear protein
  • XNPZNF-HX
  • Zinc finger helicase
  • Znf-HX

Background

The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-04611
Species: Hu
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-181
Species: Hu, Mu
Applications: WB, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000546-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ATRX Antibody (H00000546-M03) (0)

There are no publications for ATRX Antibody (H00000546-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATRX Antibody (H00000546-M03) (0)

There are no reviews for ATRX Antibody (H00000546-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATRX Antibody (H00000546-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ATRX Antibody (H00000546-M03)

Discover related pathways, diseases and genes to ATRX Antibody (H00000546-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATRX Antibody (H00000546-M03)

Discover more about diseases related to ATRX Antibody (H00000546-M03).
 

Pathways for ATRX Antibody (H00000546-M03)

View related products by pathway.

PTMs for ATRX Antibody (H00000546-M03)

Learn more about PTMs related to ATRX Antibody (H00000546-M03).
 

Research Areas for ATRX Antibody (H00000546-M03)

Find related products by research area.

Blogs on ATRX

There are no specific blogs for ATRX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATRX Antibody (5B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATRX
Entrez
Uniprot