ATPase Na+/K+ beta 3 Recombinant Protein Antigen

Images

 
There are currently no images for ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATPase Na+/K+ beta 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP1B3.

Source: E. coli

Amino Acid Sequence: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP1B3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38595.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATPase Na+/K+ beta 3 Recombinant Protein Antigen

  • ATP1B3
  • ATPase Na+/K+ beta 3
  • ATPase, Na+/K+ transporting, beta 3 polypeptide
  • ATPB-3
  • CD antigen CD298
  • CD298 antigen
  • CD298
  • FLJ29027
  • Na, K-ATPase beta-3 polypeptide
  • sodium/potassium-dependent ATPase beta-3 subunit
  • Sodium/potassium-dependent ATPase subunit beta-3
  • sodium/potassium-transporting ATPase beta-3 chain
  • sodium/potassium-transporting ATPase subunit beta-3

Background

ATPase Na+/ K+ beta 3 is encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-146
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-94614
Species: Mu, Rt
Applications: WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB300-540
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, Single-Cell Western, WB
NB300-147
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1318
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DAN00
Species: Hu
Applications: ELISA
NB100-2322
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-85666
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-54376
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-13431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP) (0)

There are no publications for ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP) (0)

There are no reviews for ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATPase Na+/K+ beta 3 Products

Research Areas for ATPase Na+/K+ beta 3 Protein (NBP2-38595PEP)

Find related products by research area.

Blogs on ATPase Na+/K+ beta 3

There are no specific blogs for ATPase Na+/K+ beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATPase Na+/K+ beta 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1B3