ATPase Na+/K+ beta 2 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP1B2. Source: E. coli
Amino Acid Sequence: TVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDST Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
ATP1B2 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90174. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for ATPase Na+/K+ beta 2 Recombinant Protein Antigen
Background
ATPase Na+/ K+ beta 2 is encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for ATPase Na+/K+ beta 2 Protein (NBP1-90174PEP) (0)
There are no publications for ATPase Na+/K+ beta 2 Protein (NBP1-90174PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ATPase Na+/K+ beta 2 Protein (NBP1-90174PEP) (0)
There are no reviews for ATPase Na+/K+ beta 2 Protein (NBP1-90174PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ATPase Na+/K+ beta 2 Protein (NBP1-90174PEP) (0)
Additional ATPase Na+/K+ beta 2 Products
Research Areas for ATPase Na+/K+ beta 2 Protein (NBP1-90174PEP)
Find related products by research area.
|
Blogs on ATPase Na+/K+ beta 2