![Western Blot: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Analysis in human heart tissue.](http://images.novusbio.com/fullsize/ATPase-Inhibitory-Factor-1-Antibody-Western-Blot-NBP1-90069-img0012.jpg "Western Blot: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Analysis in human heart tissue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATP5IF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-90069 | Applications | Species |
|---|---|---|
| Kampf C, Bergman J, Oksvold P et al. A tool to facilitate clinical biomarker studies - a tissue dictionary based on the Human Protein Atlas. BMC Med 2012-09-12 [PMID: 22971420] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATPase Inhibitory Factor 1 Antibody (NBP1-90069)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP5IF1 |
![Immunocytochemistry/Immunofluorescence: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ATPase-Inhibitory-Factor-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90069-img0006.jpg "Immunocytochemistry/Immunofluorescence: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human testis shows strong cytoplasmic granular positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ATPase-Inhibitory-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-90069-img0011.jpg "Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human testis shows strong cytoplasmic granular positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/ATPase-Inhibitory-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-90069-img0008.jpg "Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.](http://images.novusbio.com/fullsize/ATPase-Inhibitory-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-90069-img0009.jpg "Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human rectum shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/ATPase-Inhibitory-Factor-1-Antibody-Immunohistochemistry-Paraffin-NBP1-90069-img0010.jpg "Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human rectum shows strong cytoplasmic granular positivity in glandular cells.")
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")