ATPase Inhibitory Factor 1 Antibody

Images

 
Western Blot: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression ...read more
Immunocytochemistry/ Immunofluorescence: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATPase Inhibitory Factor 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATPIF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATPase Inhibitory Factor 1 Protein (NBP1-90069PEP)
Publications
Read Publication using NBP1-90069.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22971420)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATPase Inhibitory Factor 1 Antibody

  • ATP synthase inhibitor protein
  • ATPase inhibitor protein
  • ATPase inhibitor, mitochondrial
  • ATPase inhibitory factor 1
  • ATPIIF(1)
  • ATPIP
  • IF1
  • Inhibitor of F(1)F(o)-ATPase
  • IP
  • MGC1167
  • MGC8898

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
H00009669-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP2-46555
Species: Hu
Applications: WB, IHC
NBP2-02249
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP1-59168
Species: Hu
Applications: WB
H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5866
Species: Hu
Applications: WB, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP1-92372
Species: Hu
Applications: IHC, IHC-P

Publications for ATPase Inhibitory Factor 1 Antibody (NBP1-90069)(1)

Reviews for ATPase Inhibitory Factor 1 Antibody (NBP1-90069) (0)

There are no reviews for ATPase Inhibitory Factor 1 Antibody (NBP1-90069). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATPase Inhibitory Factor 1 Antibody (NBP1-90069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATPase Inhibitory Factor 1 Products

Bioinformatics Tool for ATPase Inhibitory Factor 1 Antibody (NBP1-90069)

Discover related pathways, diseases and genes to ATPase Inhibitory Factor 1 Antibody (NBP1-90069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATPase Inhibitory Factor 1 Antibody (NBP1-90069)

Discover more about diseases related to ATPase Inhibitory Factor 1 Antibody (NBP1-90069).
 

Pathways for ATPase Inhibitory Factor 1 Antibody (NBP1-90069)

View related products by pathway.

Research Areas for ATPase Inhibitory Factor 1 Antibody (NBP1-90069)

Find related products by research area.

Blogs on ATPase Inhibitory Factor 1

There are no specific blogs for ATPase Inhibitory Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATPase Inhibitory Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATPIF1