Recombinant Human ATP11C GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ATP11C GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 441-545 of Human ATP11C

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VDGLSQTDGTLTYFDKVDKNREELFLRALCLCHTVEIKTNDAVDGATESAELTYISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHTLNFDA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP11C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP11C GST (N-Term) Protein

  • ATPase IQ
  • ATPase, class VI, type 11C
  • ATPIGprobable phospholipid-transporting ATPase IG
  • ATPIQATPase class VI type 11C
  • EC 3.6.3
  • EC 3.6.3.1
  • phospholipid-transporting ATPase IG

Background

ATP11C - ATPase, Class VI, type 11C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

207-IL/CF
Species: Hu
Applications: BA
NBP1-88903
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2569
Species: Hu
Applications: ICC, WB
NBP1-77190
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
H00023263-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-30403
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15524
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-05168
Species: Hu, Mu
Applications: WB
MAB2018
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB
AF3369
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
H00023120-B01P-50ug
Species: Hu
Applications: WB
NB100-1392
Species: Hu
Applications: PEP-ELISA, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88905
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-59474
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
H00001879-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IP, KD, S-ELISA, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00286410-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ATP11C Partial Recombinant Protein (H00286410-Q01) (0)

There are no publications for ATP11C Partial Recombinant Protein (H00286410-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP11C Partial Recombinant Protein (H00286410-Q01) (0)

There are no reviews for ATP11C Partial Recombinant Protein (H00286410-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP11C Partial Recombinant Protein (H00286410-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP11C Products

Bioinformatics Tool for ATP11C Partial Recombinant Protein (H00286410-Q01)

Discover related pathways, diseases and genes to ATP11C Partial Recombinant Protein (H00286410-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP11C Partial Recombinant Protein (H00286410-Q01)

Discover more about diseases related to ATP11C Partial Recombinant Protein (H00286410-Q01).
 

Pathways for ATP11C Partial Recombinant Protein (H00286410-Q01)

View related products by pathway.

Research Areas for ATP11C Partial Recombinant Protein (H00286410-Q01)

Find related products by research area.

Blogs on ATP11C

There are no specific blogs for ATP11C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP11C GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP11C