ATP8A2 Recombinant Protein Antigen

Images

 
There are currently no images for ATP8A2 Recombinant Protein Antigen (NBP2-55197PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATP8A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP8A2.

Source: E. coli

Amino Acid Sequence: GVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP8A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55197.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP8A2 Recombinant Protein Antigen

  • aminophospholipid transporter-like, class I, type 8A, member 2
  • ATPase class I type 8A member 2
  • ATPase, aminophospholipid transporter, class I, type 8A, member 2
  • DKFZp434B1913
  • probable phospholipid-transporting ATPase IB

Background

ATP8A2 is a gene that codes for a protein that is 1148 amino acids long with a weight of approximately 129 kDa that has a shorter isoform that is 528 amino acids long and weighs approximately 59 kDa. Current studies are being done on several disorders and diseases related to this gene including influenza, epiglottitis, poliomyelitis, laryngitis, meningitis, diphtheria, tetanus, liver disease, pertussis, pharyngitis, and malaria. ATP8A2 has also been shown to have interactions with UIMC1, TMEM30A, and TMEM30B in pathways such as the ion channel transport and small molecule transmembrance transport pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81858
Species: Hu
Applications: IHC,  IHC-P, WB
137-PS
Species: Hu
Applications: BA
NB500-302
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP2-31972
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for ATP8A2 Recombinant Protein Antigen (NBP2-55197PEP) (0)

There are no publications for ATP8A2 Recombinant Protein Antigen (NBP2-55197PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP8A2 Recombinant Protein Antigen (NBP2-55197PEP) (0)

There are no reviews for ATP8A2 Recombinant Protein Antigen (NBP2-55197PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP8A2 Recombinant Protein Antigen (NBP2-55197PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP8A2 Products

Array NBP2-55197PEP

Blogs on ATP8A2

There are no specific blogs for ATP8A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP8A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP8A2