ATP6V1H Antibody


Western Blot: ATP6V1H Antibody [NBP1-85668] - Analysis in control (vector only transfected HEK293T lysate) and ATP6V1H over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunocytochemistry/ Immunofluorescence: ATP6V1H Antibody [NBP1-85668] - Staining of human cell line U-2 OS shows localization to actin filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ATP6V1H Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
Specificity of human ATP6V1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 26168401). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP6V1H Protein (NBP1-85668PEP)
Read Publication using
NBP1-85668 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26168401).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP6V1H Antibody

  • ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H
  • ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H
  • CGI-11
  • MSTP042
  • NBP1
  • Nef-binding protein 1
  • Protein VMA13 homolog
  • SFD
  • SFDalpha
  • SFDbeta
  • vacuolar ATP synthase subunit H
  • vacuolar ATPase subunit H
  • vacuolar proton pump H subunit
  • Vacuolar proton pump subunit H
  • Vacuolar proton pump subunit SFD
  • V-ATPase 50/57 kDa subunits
  • V-ATPase H subunit
  • V-ATPase subunit H
  • VMA13
  • V-type proton ATPase subunit H


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt, Po, Ca
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-WhMt
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ATP6V1H Antibody (NBP1-85668)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ATP6V1H Antibody (NBP1-85668) (0)

There are no reviews for ATP6V1H Antibody (NBP1-85668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V1H Antibody (NBP1-85668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ATP6V1H Products

Bioinformatics Tool for ATP6V1H Antibody (NBP1-85668)

Discover related pathways, diseases and genes to ATP6V1H Antibody (NBP1-85668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1H Antibody (NBP1-85668)

Discover more about diseases related to ATP6V1H Antibody (NBP1-85668).

Pathways for ATP6V1H Antibody (NBP1-85668)

View related products by pathway.

PTMs for ATP6V1H Antibody (NBP1-85668)

Learn more about PTMs related to ATP6V1H Antibody (NBP1-85668).

Blogs on ATP6V1H

There are no specific blogs for ATP6V1H, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP6V1H Antibody and receive a gift card or discount.


Gene Symbol ATP6V1H