ATP6V1H Antibody

Images

 
Western Blot: ATP6V1H Antibody [NBP1-85668] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ATP6V1H Antibody [NBP1-85668] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V1H Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
Specificity
Specificity of human ATP6V1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP6V1H Protein (NBP1-85668PEP)
Publications
Read Publication using
NBP1-85668 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26168401).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V1H Antibody

  • ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H
  • ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H
  • CGI-11
  • MSTP042
  • NBP1
  • Nef-binding protein 1
  • Protein VMA13 homolog
  • SFD
  • SFDalpha
  • SFDbeta
  • vacuolar ATP synthase subunit H
  • vacuolar ATPase subunit H
  • vacuolar proton pump H subunit
  • Vacuolar proton pump subunit H
  • Vacuolar proton pump subunit SFD
  • V-ATPase 50/57 kDa subunits
  • V-ATPase H subunit
  • V-ATPase subunit H
  • VMA13
  • V-type proton ATPase subunit H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00028299-P01
Species: Hu
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP2-00834
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85668
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP6V1H Antibody (NBP1-85668)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ATP6V1H Antibody (NBP1-85668) (0)

There are no reviews for ATP6V1H Antibody (NBP1-85668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V1H Antibody (NBP1-85668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1H Products

Bioinformatics Tool for ATP6V1H Antibody (NBP1-85668)

Discover related pathways, diseases and genes to ATP6V1H Antibody (NBP1-85668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1H Antibody (NBP1-85668)

Discover more about diseases related to ATP6V1H Antibody (NBP1-85668).
 

Pathways for ATP6V1H Antibody (NBP1-85668)

View related products by pathway.

PTMs for ATP6V1H Antibody (NBP1-85668)

Learn more about PTMs related to ATP6V1H Antibody (NBP1-85668).

Blogs on ATP6V1H

There are no specific blogs for ATP6V1H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1H