ATP6V1H Antibody

Western Blot: ATP6V1H Antibody [NBP1-85668] - Analysis in control (vector only transfected HEK293T lysate) and ATP6V1H over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ATP6V1H Antibody [NBP1-85668] - Staining of human cell line U-2 OS shows localization to actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.

Immunohistochemistry-Paraffin: ATP6V1H Antibody [NBP1-85668] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ATP6V1H Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
• Specificity: Specificity of human ATP6V1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V1H
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 26168401). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATP6V1H Protein (NBP1-85668PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26168401).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP6V1H Antibody

• ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H
• ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H
• CGI-11
• MSTP042
• NBP1
• Nef-binding protein 1
• Protein VMA13 homolog
• SFD
• SFDalpha
• SFDbeta
• vacuolar ATP synthase subunit H
• vacuolar ATPase subunit H
• vacuolar proton pump H subunit
• Vacuolar proton pump subunit H
• Vacuolar proton pump subunit SFD
• V-ATPase 50/57 kDa subunits
• V-ATPase H subunit
• V-ATPase subunit H
• VMA13
• V-type proton ATPase subunit H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V1H Antibody (NBP1-85668)(1)

Publication using NBP1-85668

• Rushika M. Perera, Svetlana Stoykova, Brandon N. Nicolay et al. Transcriptional control of autophagy-lysosome function drives pancreatic cancer metabolism. Nature 2015 Jul 13 [PMID: 26168401] (IHC, Human)

Bioinformatics

• Gene Symbol: ATP6V1H