Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE |
Specificity | Specificity of human ATP6V1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ATP6V1H |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | IHC reported in scientific literature (PMID: 26168401). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-85668 | Applications | Species |
---|---|---|
Rushika M. Perera, Svetlana Stoykova, Brandon N. Nicolay et al. Transcriptional control of autophagy-lysosome function drives pancreatic cancer metabolism. Nature 2015 Jul 13 [PMID: 26168401] (IHC, Human) | IHC | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for ATP6V1H Antibody (NBP1-85668)Discover more about diseases related to ATP6V1H Antibody (NBP1-85668).
| Pathways for ATP6V1H Antibody (NBP1-85668)View related products by pathway.
|
PTMs for ATP6V1H Antibody (NBP1-85668)Learn more about PTMs related to ATP6V1H Antibody (NBP1-85668).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ATP6V1H |