We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human ATP6V1G3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human ATP6V1G3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-118 of Human ATP6V1G3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ATP6V1G3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
40.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP6V1G3 GST (N-Term) Protein

  • ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
  • H+ transporting, lysosomal (vacuolar proton pump) subunit G3
  • MGC119810
  • MGC119813
  • vacuolar ATP synthase subunit G 3
  • vacuolar proton pump G subunit 3
  • Vacuolar proton pump subunit G 3
  • vacuolar proton pump, subunit G3
  • V-ATPase 13 kDa subunit 3
  • V-ATPase G subunit 3
  • V-ATPase G3 subunit
  • V-ATPase subunit G 3
  • V-type proton ATPase subunit G 3

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89330
Species: Hu
Applications: IHC,  IHC-P
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46556
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-31600
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-49059
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-06290
Species: Hu
Applications: IHC,  IHC-P
NBP1-32980
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP3-47877
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-00580
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15520
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88891
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00127124-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for ATP6V1G3 Recombinant Protein (H00127124-P01) (0)

There are no publications for ATP6V1G3 Recombinant Protein (H00127124-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1G3 Recombinant Protein (H00127124-P01) (0)

There are no reviews for ATP6V1G3 Recombinant Protein (H00127124-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1G3 Recombinant Protein (H00127124-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V1G3 Products

Research Areas for ATP6V1G3 Recombinant Protein (H00127124-P01)

Find related products by research area.

Blogs on ATP6V1G3

There are no specific blogs for ATP6V1G3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP6V1G3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1G3