Recombinant Human ATP6V1G3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATP6V1G3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 38 - 118 of Human ATP6V1G3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP6V1G3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATP6V1G3 Protein

  • ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
  • H+ transporting, lysosomal (vacuolar proton pump) subunit G3
  • MGC119810
  • MGC119813
  • vacuolar ATP synthase subunit G 3
  • vacuolar proton pump G subunit 3
  • Vacuolar proton pump subunit G 3
  • vacuolar proton pump, subunit G3
  • V-ATPase 13 kDa subunit 3
  • V-ATPase G subunit 3
  • V-ATPase G3 subunit
  • V-ATPase subunit G 3
  • V-type proton ATPase subunit G 3

Background

ATP6V1G3 - ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46556
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49059
Species: Hu
Applications: WB, IHC
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP1-85668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-00580
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88891
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00127124-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01) (0)

There are no publications for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01) (0)

There are no reviews for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V1G3 Products

Bioinformatics Tool for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01)

Discover related pathways, diseases and genes to ATP6V1G3 Partial Recombinant Protein (H00127124-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01)

Discover more about diseases related to ATP6V1G3 Partial Recombinant Protein (H00127124-Q01).
 

Pathways for ATP6V1G3 Partial Recombinant Protein (H00127124-Q01)

View related products by pathway.

Blogs on ATP6V1G3

There are no specific blogs for ATP6V1G3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD20 Antibody (AISB12)
NBP1-43435-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATP6V1G3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1G3