ATP6V1B1 Recombinant Protein Antigen

Images

 
There are currently no images for ATP6V1B1 Protein (NBP2-33962PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATP6V1B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V1B1.

Source: E.coli

Amino Acid Sequence: MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6V1B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33962.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ATP6V1B1 Recombinant Protein Antigen

  • ATP6B158kD subunit
  • ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1
  • Endomembrane proton pump 58 kDa subunit
  • H+-ATPase beta 1 subunit
  • vacuolar proton pump 3
  • Vacuolar proton pump subunit B 1
  • vacuolar proton pump, subunit 3
  • VATBMGC32642
  • V-ATPase B1 subunit
  • V-ATPase subunit B 1
  • Vma2
  • V-type proton ATPase subunit B, kidney isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-88890
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-58586
Species: Hu
Applications: WB, ICC/IF
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33962PEP
Species: Hu
Applications: AC

Publications for ATP6V1B1 Protein (NBP2-33962PEP) (0)

There are no publications for ATP6V1B1 Protein (NBP2-33962PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1B1 Protein (NBP2-33962PEP) (0)

There are no reviews for ATP6V1B1 Protein (NBP2-33962PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP6V1B1 Protein (NBP2-33962PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ATP6V1B1 Products

Bioinformatics Tool for ATP6V1B1 Protein (NBP2-33962PEP)

Discover related pathways, diseases and genes to ATP6V1B1 Protein (NBP2-33962PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1B1 Protein (NBP2-33962PEP)

Discover more about diseases related to ATP6V1B1 Protein (NBP2-33962PEP).
 

Pathways for ATP6V1B1 Protein (NBP2-33962PEP)

View related products by pathway.

PTMs for ATP6V1B1 Protein (NBP2-33962PEP)

Learn more about PTMs related to ATP6V1B1 Protein (NBP2-33962PEP).

Blogs on ATP6V1B1

There are no specific blogs for ATP6V1B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP6V1B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1B1