ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for ATP6V0D2 Antibody (H00245972-M01)
Discover related pathways, diseases and genes to ATP6V0D2 Antibody (H00245972-M01). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ATP6V0D2 Antibody (H00245972-M01)
Discover more about diseases related to ATP6V0D2 Antibody (H00245972-M01).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ATP6V0D2 Antibody (7A4) and receive a gift card or discount.