ATP6V0D2 Antibody (7A4) - Azide and BSA Free

Sandwich ELISA: ATP6V0D2 Antibody (7A4) [H00245972-M01] - Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 7A4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP6V0D2 Antibody (7A4) - Azide and BSA Free Summary

• Immunogen: ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
• Specificity: ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP6V0D2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V0D2 Antibody (7A4) - Azide and BSA Free

• ATP6D2
• ATP6V0
• ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
• FLJ38708
• Vacuolar proton pump subunit d 2
• V-ATPase subunit d 2
• VMA6
• V-type proton ATPase subunit d 2

Background

ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0D2 Antibody (H00245972-M01)(2)

Publications using H00245972-M01

• Liu S, Zhu W, Li S et al. Bovine parathyroid hormone enhances osteoclast bone resorption by modulating V-ATPase through PTH1R. Int J Mol Med 2016-02-01 [PMID: 26647715] (WB)
• Teramachi J, Zhou H, Subler MA et al. Increased IL-6 expression in osteoclasts is necessary but not sufficient for the development of Paget's disease of bone. J Bone Miner Res. 2014-06-01 [PMID: 24339057]

Bioinformatics

• Gene Symbol: ATP6V0D2
• Entrez:
  • 245972(Human)
• Uniprot:
  • NP_689778(Human)