Home » ATP6V0D2 » ATP6V0D2 Antibodies » ATP6V0D2 Antibody (7A4)

ATP6V0D2 Antibody (7A4)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: ATP6V0D2 Antibody (7A4) [H00245972-M01] - Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.
Sandwich ELISA: ATP6V0D2 Antibody (7A4) [H00245972-M01] - Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
7A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ATP6V0D2 Antibody (7A4) Summary

Immunogen
ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN
Specificity
ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP6V0D2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00245972-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V0D2 Antibody (7A4)

  • ATP6D2
  • ATP6V0
  • ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
  • FLJ38708
  • Vacuolar proton pump subunit d 2
  • V-ATPase subunit d 2
  • VMA6
  • V-type proton ATPase subunit d 2

Background

ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DIO2 Antibody
NBP1-00178
Flow Cytometry: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5%Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody
Immunocytochemistry/Immunofluorescence: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton.Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Frozen: DIO2 Antibody [NBP1-00178] - IHC analysis of DIO2 in cryo-sectioned Mouse Hippocampus using NBP1-00178 at 2ug/ml. Microwaved antigen retrieval with citrate buffer pH 4.5, HRP-staining.
(7 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human kidney shows strong cytoplasmic postivity in cells in tubules.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
ATP6V0A4 Antibody
NBP1-89330
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining in human kidney and lymph node tissues using anti-ATP6V0A4 antibody. Corresponding ATP6V0A4 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
ATP6V1B1 Antibody
(OTI1H6)
NBP2-00580
Flow Cytometry: ATP6V1B1 Antibody (1H6) [NBP2-00580] - Analysis of Hela cells, using anti-ATP6V1B1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: ATP6V1B1 Antibody (1H6) [NBP2-00580] - Analysis of Jurkat cells, using anti-ATP6V1B1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: ATP6V1B1 Antibody (1H6) [NBP2-00580] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-ATP6V1B1 antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HNRNPC antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining of human rectum shows strong nuclear immunoreactivity in glandular and lamina propria cells.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining of human small intestine shows strong nuclear positivity in glandular epithelium and in lamina propria cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
TCIRG1 Antibody
NBP1-89333
Immunocytochemistry/Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NFATC1/NFAT2
Antibody
NB100-56732
Western Blot: NFATC1/NFAT2 Antibody [NB100-56732] - Immortalized mouse podocytes. Image from verified customer review.
Simple Western: NFATC1/NFAT2 Antibody [NB100-56732] - Lane view shows a specific band for NFAT2 in 0.5 mg/ml of RAW lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: NFATC1/NFAT2 Antibody [NB100-56732] - Analysis of human (A)Ramos and (B) mouse RAW lysate using NFATc1 antibody at 1 ug/ml.
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
ATP6V1G3 Antibody
NBP1-88894
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Analysis in human kidney and skin tissues using NBP1-88894 antibody. Corresponding ATP6V1G3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
ATP6V1C2 Antibody
(OTI8H4)
NBP2-46556
Immunohistochemistry: ATP6V1C2 Antibody (8H4) [NBP2-46556] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: ATP6V1C2 Antibody (8H4) [NBP2-46556] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: ATP6V1C2 Antibody (8H4) [NBP2-46556] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ATP6V0A2 Antibody
NBP1-59069
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.
Immunohistochemistry-Paraffin: ATP6V0A2 Antibody [NBP1-59069] - overexpressed mouse sequences tissue
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RFC2 Antibody
(OTI2B2) - Azide and ...
NBP2-73857
Western Blot: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Flow Cytometry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by RFC2 antibody.
Immunohistochemistry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of Adenocarcinoma of Human endometrium tissue.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc).  PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human RFC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6457) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RFC1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
gamma Sarcoglycan
Antibody
NBP1-90299
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining in human heart muscle and prostate tissues using anti-SGCG antibody. Corresponding SGCG RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PLP2 Antibody
NBP3-06290
Immunohistochemistry: PLP2 Antibody [NBP3-06290] - Immunochemical staining of human PLP2 in human kidney with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: PLP2 Antibody [NBP3-06290] - Immunochemical staining of human PLP2 in human liver with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: IHC, IHC-P
ARHGAP4 Antibody
NBP1-88527
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human spleen shows high expression.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IP, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB

Publications for ATP6V0D2 Antibody (H00245972-M01)(2)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for ATP6V0D2 Antibody (H00245972-M01) (0)

There are no reviews for ATP6V0D2 Antibody (H00245972-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0D2 Antibody (H00245972-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V0D2 Products

Bioinformatics Tool for ATP6V0D2 Antibody (H00245972-M01)

Discover related pathways, diseases and genes to ATP6V0D2 Antibody (H00245972-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0D2 Antibody (H00245972-M01)

Discover more about diseases related to ATP6V0D2 Antibody (H00245972-M01).
 

Pathways for ATP6V0D2 Antibody (H00245972-M01)

View related products by pathway.

PTMs for ATP6V0D2 Antibody (H00245972-M01)

Learn more about PTMs related to ATP6V0D2 Antibody (H00245972-M01).

Blogs on ATP6V0D2

There are no specific blogs for ATP6V0D2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0D2 Antibody (7A4) and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP6V0D2
Entrez
Uniprot