ATP6V0A1 Antibody

Images

 
Western Blot: ATP6V0A1 Antibody [H00000535-A01] - Detection against Immunogen (35.68 KDa)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP6V0A1 Antibody Summary

Immunogen
ATP6V0A1 (NP_005168, 212 a.a. - 298 a.a.) partial recombinant protein with GST tag. GDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVR
Specificity
ATP6V0A1 - ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ATP6V0A1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Publications
Read Publication using H00000535-A01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50 % glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V0A1 Antibody

  • a1
  • ATP6N1
  • ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
  • ATP6V0
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
  • ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
  • ATPase, H+ transporting, lysosomal V0 subunit a1
  • Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
  • DKFZp781J1951
  • Stv1
  • Vacuolar adenosine triphosphatase subunit Ac116
  • Vacuolar proton pump subunit 1
  • vacuolar proton pump, subunit 1
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • vacuolar-type H(+)-ATPase 115 kDa subunit
  • V-ATPase 116 kDa isoform a1
  • V-ATPase 116 kDa
  • Vph1
  • VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
  • V-type proton ATPase 116 kDa subunit a isoform 1
  • V-type proton ATPase 116 kDa subunit a

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. The occurrence of splice variants encoding different protein products has been reported, but the full-length natures of these transcripts have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-06290
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF1936
Species: Hu
Applications: IP, WB
210-TA
Species: Hu
Applications: BA
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-88996
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB

Publications for ATP6V0A1 Antibody (H00000535-A01)(1)

Reviews for ATP6V0A1 Antibody (H00000535-A01) (0)

There are no reviews for ATP6V0A1 Antibody (H00000535-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V0A1 Antibody (H00000535-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V0A1 Products

Bioinformatics Tool for ATP6V0A1 Antibody (H00000535-A01)

Discover related pathways, diseases and genes to ATP6V0A1 Antibody (H00000535-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0A1 Antibody (H00000535-A01)

Discover more about diseases related to ATP6V0A1 Antibody (H00000535-A01).
 

Pathways for ATP6V0A1 Antibody (H00000535-A01)

View related products by pathway.

Blogs on ATP6V0A1

There are no specific blogs for ATP6V0A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0A1
Entrez
OMIM
Uniprot