ATP6V0A1 Antibody Summary
                         
                                
                                
                                
            | Description | 
            Quality control test: Antibody Reactive Against Recombinant Protein.  | 
        
            | Immunogen | 
            ATP6V0A1 (NP_005168, 212 a.a. - 298 a.a.) partial recombinant protein with GST tag. GDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVR  | 
        
            | Specificity | 
            ATP6V0A1 - ATPase, H+ transporting, lysosomal V0 subunit a isoform 1  | 
        
            | Isotype | 
            IgG  | 
        
            | Clonality | 
            Polyclonal  | 
        
            | Host | 
            Mouse  | 
        
            | Gene | 
            ATP6V0A1  | 
        
            | Purity | 
            Unpurified  | 
        
            | Innovator's Reward | 
            Test in a species/application not listed above to receive a full credit towards a future purchase.  | 
        
                                
                          Applications/Dilutions
                                
                                    
                                    
                                        
                              
                                  | Dilutions | 
                                  
                                      - ELISA 
 - Immunocytochemistry/ Immunofluorescence 
 - Western Blot 
 
                                       
                                   | 
                              
            | Application Notes | 
            The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500  | 
        
                                        | Publications | 
                                        
                                            
                                         | 
                                    
                                    
                                  Packaging, Storage & Formulations
            | Storage | 
            Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.  | 
        
            | Buffer | 
            50 % glycerol  | 
        
            | Preservative | 
            No Preservative  | 
        
            | Purity | 
            Unpurified  | 
        
  Notes
                    
                        This product is produced by and distributed for Abnova, a company based in Taiwan.
                     Alternate Names for ATP6V0A1 Antibody
                     Background
 
                    
                    This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. The occurrence of splice variants encoding different protein products has been reported, but the full-length natures of these transcripts have not been determined.
                      Limitations
 
                    
                    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are 
guaranteed for 1 year from date of receipt.
 
                     Customers Who Viewed This Item Also Viewed...
                
                
                            
                                  
                                       Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: ICC/IF, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu
Applications: Flow, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: ICC/IF, IP, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: ICC/IF, IHC,  IHC-P
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: ICC/IF, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: IHC,  IHC-P
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Bv, Hu, Mu
Applications: ICC, IHC
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu
Applications: IP, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Hu
Applications: BA
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                              
                      
                  Publications for ATP6V0A1 Antibody (H00000535-A01)(3)
              
                        
                        Showing Publications 1 - 
3 of 3.
                         
             
                        
                        Reviews for ATP6V0A1 Antibody (H00000535-A01) (0)	
                        
                        There are no reviews for ATP6V0A1 Antibody (H00000535-A01).
                        By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount. 
                            
                                - Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
 
                                - Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
 
                            
                                   
                  Product General Protocols
                        
                        Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
                        
Video Protocols
                        
                          FAQs for ATP6V0A1 Antibody (H00000535-A01) (0)
                        
                             
                  
                Secondary Antibodies
                    
                      |   | 
                Isotype Controls
                    
                     | 
Additional ATP6V0A1 Products
                            
                            Blogs on ATP6V0A1