ATP5O Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ATP5O Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP5O.
  
  

  Source: E. coli

  Amino Acid Sequence: LEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ATP5PO
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32602.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP5O Recombinant Protein Antigen

• ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
• human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial
• Oligomycin sensitivity conferral protein
• oligomycin sensitivity conferring protein
• OSCPhuman ATP synthase OSCP subunit

Background

ATP5O is a 213 amino acid F-type ATPase protein that is involved in producing ATP from ADP in the mitochondrial membrane when a proton gradient has been established across the membrane through the movement of charges across an electron transport complex in the respiratory chain. Current research is being performed on several diseases and disorders including graves disease, hashimotos thyroiditis, hypothyroidism, autoimmunity, goiter, diabetes mellitus, Huntington's disease, stomach cancer, osteoporosis, Parkinsons, twinning, osteosarcoma, hepatitis, and malaria. This protein has also been shown to have interactions with ATP5A1, ATP5B, ATP5D, IKBKG, and MPG in pathways such as the oxidative phosphorylation, metabolic, citric acid cycle (TCA), and Alzheimer's pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ATP5PO