ATP5O Antibody

Western Blot: ATP5O Antibody [H00000539-B01P] - Analysis of ATP5O expression in human kidney.

Immunocytochemistry/Immunofluorescence: ATP5O Antibody [H00000539-B01P] - Analysis of purified antibody to ATP5O on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: ATP5O Antibody [H00000539-B01P] - Analysis of ATP5O expression in transfected 293T cell line by ATP5O polyclonal antibody. Lane 1: ATP5O transfected lysate(23.54 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

ATP5O Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ATP5O (AAH21233, 1 a.a. - 213 a.a.) full-length human protein. MAAPAVSGLSRQVRCLSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ATP5PO
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5O Antibody

• ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
• human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial
• Oligomycin sensitivity conferral protein
• oligomycin sensitivity conferring protein
• OSCPhuman ATP synthase OSCP subunit

Background

ATP5O is a 213 amino acid F-type ATPase protein that is involved in producing ATP from ADP in the mitochondrial membrane when a proton gradient has been established across the membrane through the movement of charges across an electron transport complex in the respiratory chain. Current research is being performed on several diseases and disorders including graves disease, hashimotos thyroiditis, hypothyroidism, autoimmunity, goiter, diabetes mellitus, Huntington's disease, stomach cancer, osteoporosis, Parkinsons, twinning, osteosarcoma, hepatitis, and malaria. This protein has also been shown to have interactions with ATP5A1, ATP5B, ATP5D, IKBKG, and MPG in pathways such as the oxidative phosphorylation, metabolic, citric acid cycle (TCA), and Alzheimer's pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5PO
• Uniprot:
  • AAH21233(Human)