Home » ATP5O » ATP5O Antibodies » ATP5O Antibody

ATP5O Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ATP5O Antibody [H00000539-B01P] - Analysis of ATP5O expression in human kidney.
Western Blot: ATP5O Antibody [H00000539-B01P] - Analysis of ATP5O expression in human kidney.
Immunocytochemistry/ Immunofluorescence: ATP5O Antibody [H00000539-B01P] - Analysis of purified antibody to ATP5O on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: ATP5O Antibody [H00000539-B01P] - Analysis of ATP5O expression in transfected 293T cell line by ATP5O polyclonal antibody. Lane 1: ATP5O transfected lysate(23.54 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ATP5O Antibody Summary

Immunogen
ATP5O (AAH21233, 1 a.a. - 213 a.a.) full-length human protein. MAAPAVSGLSRQVRCLSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ATP5O
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5O Antibody

  • ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
  • human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial
  • Oligomycin sensitivity conferral protein
  • oligomycin sensitivity conferring protein
  • OSCPhuman ATP synthase OSCP subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATP5J Antibody
NBP1-88888
Western Blot: ATP5J Antibody [NBP1-88888] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: ATP5J Antibody [NBP1-88888] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ATP5J Antibody [NBP1-88888] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ATPase Inhibitory
Factor 1 Antibody
NBP1-90069
Western Blot: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ATPase Inhibitory Factor 1 Antibody [NBP1-90069] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ATP5E Antibody
NBP1-42805
ATP5E Antibody
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
Sodium Potassium
ATPase Beta 1 Antibod ...
NB300-147
Western Blot: Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A)) [NB300-147] - Western blot analysis of Sodium Potassium ATPase Beta 1 expression in 1) SK-BR-3 and 2) A-431 whole cell lysates using NB300-147.
Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A)) [NB300-147] - Sodium Potassium ATPase Beta 1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A)) [NB300-147] - Detection of Na, K-ATPase (beta) in rat kidney homogenates (20 ug)using NB 300-147. Lane 1: 1:2,500 primary. Lane 2: 1:5,000 primary.
(12 Publications)
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - analysis of EXOSC10 in HeLa whole cell extracts treated with (1) si-control and (2) EXOSC10 siRNA using anti-EXOSC10 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NDUFA12 Antibody
NBP1-88935
Western Blot: NDUFA12 Antibody [NBP1-88935] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: NDUFA12 Antibody [NBP1-88935] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Thyroglobulin
Antibody (2H11+6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
UQCRH Antibody
NBP1-93442
Western Blot: UQCRH Antibody [NBP1-93442] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: UQCRH Antibody [NBP1-93442] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Western Blot: UQCRH Antibody [NBP1-93442] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
RPLP2 Antibody
NBP2-15104
Western Blot: RPLP2 Antibody [NBP2-15104] - Sample (30 ug of whole cell lysate) A: 293T 15% SDS PAGE diluted at 1:10000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RPLP2 Antibody [NBP2-15104] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPLP2 Antibody [NBP2-15104] - Paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

FABP8/M-FABP/Myelin P2
AF5866
Western blot shows lysates of human hippocampal and rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for FABP8 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
FABP8 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP8 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Thyroid Peroxidase
Antibody
NBP1-80670
Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP1-80670] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP1-80670] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP1-80670] - Staining in human thyroid gland and cerebral cortex tissues using anti-TPO antibody. Corresponding TPO RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
ER alpha/NR3A1
Antibody (EVG F9)
NB100-74413
Western Blot: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of various whole cell lysates.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of Estrogen Receptor alpha using Anti-Estrogen Receptor alpha Monoclonal Antibody (EVG F9) shows staining in U251 Cells. Estrogen Receptor alpha staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Estrogen Receptor alpha at a dilution of 1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Cancer biopsies of deparaffinized Human breast carcinoma tissues.
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
FACA/FANCA Antibody
NB100-2564
Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.
(1 Publication)
Species: Hu
Applications: WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-56762
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Staining of human cell line PC-3 shows localization to mitochondria.
Species: Hu
Applications: WB, ICC/IF
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [1761].
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Frataxin Antibody
(OTI1C12)
NBP2-01743
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunocytochemistry/Immunofluorescence: Frataxin Antibody (1C12) [NBP2-01743] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Human prostate tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ATP5O Antibody (H00000539-B01P) (0)

There are no publications for ATP5O Antibody (H00000539-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5O Antibody (H00000539-B01P) (0)

There are no reviews for ATP5O Antibody (H00000539-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP5O Antibody (H00000539-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5O Products

Bioinformatics Tool for ATP5O Antibody (H00000539-B01P)

Discover related pathways, diseases and genes to ATP5O Antibody (H00000539-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5O Antibody (H00000539-B01P)

Discover more about diseases related to ATP5O Antibody (H00000539-B01P).
 

Pathways for ATP5O Antibody (H00000539-B01P)

View related products by pathway.

PTMs for ATP5O Antibody (H00000539-B01P)

Learn more about PTMs related to ATP5O Antibody (H00000539-B01P).
 

Research Areas for ATP5O Antibody (H00000539-B01P)

Find related products by research area.

Blogs on ATP5O

There are no specific blogs for ATP5O, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5O Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP5O
Uniprot