ATP5I Antibody (1E6.)

Images

 
There are currently no images for ATP5I Antibody (H00000521-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP5I Antibody (1E6.) Summary

Immunogen
ATP5I (AAH03679, 1 a.a. - 69 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Specificity
ATP5I (1E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP5I
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5I Antibody (1E6.)

  • ATP synthase e chain, mitochondrial
  • ATP synthase subunit e, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E
  • ATP5K
  • ATPase subunit e
  • F1F0-ATP synthase, murine e subunit
  • MGC12532

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the F0 complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-88425
Species: Hu
Applications: IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-13865
Species: Hu
Applications: IHC, IHC-P
NBP2-02588
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3320
Species: Hu
Applications: WB, IHC
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83565
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP5I Antibody (H00000521-M01) (0)

There are no publications for ATP5I Antibody (H00000521-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5I Antibody (H00000521-M01) (0)

There are no reviews for ATP5I Antibody (H00000521-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP5I Antibody (H00000521-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5I Products

Bioinformatics Tool for ATP5I Antibody (H00000521-M01)

Discover related pathways, diseases and genes to ATP5I Antibody (H00000521-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5I Antibody (H00000521-M01)

Discover more about diseases related to ATP5I Antibody (H00000521-M01).
 

Pathways for ATP5I Antibody (H00000521-M01)

View related products by pathway.

PTMs for ATP5I Antibody (H00000521-M01)

Learn more about PTMs related to ATP5I Antibody (H00000521-M01).

Blogs on ATP5I

There are no specific blogs for ATP5I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5I Antibody (1E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5I
Entrez
OMIM
Uniprot