ATP5H Antibody

Western Blot: ATP5H Antibody [H00010476-B01P] - Analysis of ATP5H expression in transfected 293T cell line by ATP5H polyclonal antibody. Lane 1: ATP5H transfected lysate(17.71 KDa). Lane 2: Non-transfected lysate.

Western Blot: ATP5H Antibody [H00010476-B01P] - ATP5H MaxPab polyclonal antibody. Western Blot analysis of ATP5H expression in human liver.

Product Discontinued

ATP5H Antibody Summary

• Immunogen: ATP5H (NP_006347, 1 a.a. - 161 a.a.) full-length human protein. MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
• Specificity: Reacts with ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ATP5PD
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5H Antibody

• ATP synthase D chain, mitochondrial
• ATP synthase subunit d, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d
• ATP synthase, H+ transporting, mitochondrial F1F0, subunit d
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d
• ATP5JD
• ATPase subunit d
• ATPQ
• My032 protein

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the F0 complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5PD
• Entrez:
  • 10476(Human)
• Uniprot:
  • NP_006347(Human)