ATP5F1 Antibody

Western Blot: ATP5F1 Antibody [H00000515-B02P] - Analysis of ATP5F1 expression in transfected 293T cell line by ATP5F1 polyclonal antibody. Lane 1: ATP5F1 transfected lysate(28.16 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

ATP5F1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ATP5F1 (NP_001679.2, 1 a.a. - 256 a.a.) full-length human protein. MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
• Specificity: ATP5F1 - ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ATP5PB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5F1 Antibody

• ATP synthase B chain, mitochondrial
• ATP synthase subunit b, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
• ATPase subunit b
• cell proliferation-inducing protein 47
• H+-ATP synthase subunit b
• MGC24431
• PIG47

Background

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP5PB
• Entrez:
  • 515(Human)
• Uniprot:
  • NP_001679.2(Human)