ATP5F1 Antibody

Images

 
Western Blot: ATP5F1 Antibody [H00000515-B01P] - Analysis of ATP5F1 expression in transfected 293T cell line by ATP5F1 polyclonal antibody. Lane 1: ATP5F1 transfected lysate(28.27 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP5F1 Antibody Summary

Immunogen
ATP5F1 (AAH05366, 1 a.a. - 256 a.a.) full-length human protein. MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ATP5F1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5F1 Antibody

  • ATP synthase B chain, mitochondrial
  • ATP synthase subunit b, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
  • ATPase subunit b
  • cell proliferation-inducing protein 47
  • H+-ATP synthase subunit b
  • MGC24431
  • PIG47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-98474
Species: Hu
Applications: WB
NBP1-85968
Species: Hu
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
AF4828
Species: Hu, Mu
Applications: WB, IHC
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00580
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88890
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP5F1 Antibody (H00000515-B01P) (0)

There are no publications for ATP5F1 Antibody (H00000515-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5F1 Antibody (H00000515-B01P) (0)

There are no reviews for ATP5F1 Antibody (H00000515-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5F1 Antibody (H00000515-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5F1 Products

Bioinformatics Tool for ATP5F1 Antibody (H00000515-B01P)

Discover related pathways, diseases and genes to ATP5F1 Antibody (H00000515-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5F1 Antibody (H00000515-B01P)

Discover more about diseases related to ATP5F1 Antibody (H00000515-B01P).
 

Pathways for ATP5F1 Antibody (H00000515-B01P)

View related products by pathway.

Blogs on ATP5F1

There are no specific blogs for ATP5F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5F1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5F1
Uniprot