ATP11B Antibody

Immunohistochemistry-Paraffin: ATP11B Antibody [NBP1-88901] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ATP11B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRN
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP11B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ATP11B Protein (NBP1-88901PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP11B Antibody

• ATPase class VI type 11B
• ATPase IR
• ATPase, class VI, type 11B
• ATPIFKIAA0956probable phospholipid-transporting ATPase IF
• ATPIRMGC46576
• DKFZp434J238
• DKFZp434N1615
• EC 3.6.3
• EC 3.6.3.1

Background

ATP11B - ATPase, Class VI, type 11B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP11B