ATP11B Antibody

Images

 
Immunohistochemistry-Paraffin: ATP11B Antibody [NBP1-88900] - Staining of human stomach shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP11B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPENETELIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP11B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP11B Protein (NBP1-88900PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP11B Antibody

  • ATPase class VI type 11B
  • ATPase IR
  • ATPase, class VI, type 11B
  • ATPIFKIAA0956probable phospholipid-transporting ATPase IF
  • ATPIRMGC46576
  • DKFZp434J238
  • DKFZp434N1615
  • EC 3.6.3
  • EC 3.6.3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77189
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-88902
Species: Hu
Applications: IHC, IHC-P
NBP1-83256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89546
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004168-B01P-50ug
Species: Hu
Applications: WB
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-90840
Species: Hu
Applications: IHC, IHC-P
AF2569
Species: Hu
Applications: WB, ICC
NBP1-88905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP1-90069
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
NBP1-88900
Species: Hu
Applications: IHC, IHC-P

Publications for ATP11B Antibody (NBP1-88900) (0)

There are no publications for ATP11B Antibody (NBP1-88900).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP11B Antibody (NBP1-88900) (0)

There are no reviews for ATP11B Antibody (NBP1-88900). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP11B Antibody (NBP1-88900) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP11B Products

Bioinformatics Tool for ATP11B Antibody (NBP1-88900)

Discover related pathways, diseases and genes to ATP11B Antibody (NBP1-88900). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP11B Antibody (NBP1-88900)

Discover more about diseases related to ATP11B Antibody (NBP1-88900).
 

Pathways for ATP11B Antibody (NBP1-88900)

View related products by pathway.

Blogs on ATP11B

There are no specific blogs for ATP11B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP11B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP11B