ATG4D Recombinant Protein Antigen

Images

 
There are currently no images for ATG4D Recombinant Protein Antigen (NBP2-49525PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATG4D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATG4D.

Source: E. coli

Amino Acid Sequence: LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATG4D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49525.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATG4D Recombinant Protein Antigen

  • APG4 autophagy 4 homolog D (S. cerevisiae)
  • APG4 autophagy 4 homolog D
  • APG4D
  • APG4-D
  • ATG4 autophagy related 4 homolog D (S. cerevisiae)
  • AUTL4
  • AUT-like 4 cysteine endopeptidase
  • AUT-like 4, cysteine endopeptidase (S. cerevisiae)
  • AUT-like 4, cysteine endopeptidase
  • autophagin-4
  • Autophagy-related cysteine endopeptidase 4
  • Autophagy-related protein 4 homolog D
  • cysteine protease ATG4D
  • cysteine protease involved in autophagy
  • EC 3.4.22
  • EC 3.4.22.-

Background

ATG4D is a gene that codes for a protein expressed in the skeletal muscle and testis and is 474 amino acids long with a weight of approximately 53 kDa. ATG4D is a cysteine protease required for autophagy. ATG4D has been shown to have interactions with TAF12, CASP3, CASP8, GABARAP, and UBC in pathways such as the regulation of autophagy pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-55202
Species: Hu
Applications: IHC,  IHC-P, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP2-24709
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB4324
Species: Hu, Mu
Applications: ICC, IP, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NBP2-15501
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-61690
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NB110-60928
Species: Al, Bv, Ca, Hu, Mu, Pm, Rt
Applications: EM, IHC,  IHC-P, WB
NBP1-76845
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
NBP3-32059
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB

Publications for ATG4D Recombinant Protein Antigen (NBP2-49525PEP) (0)

There are no publications for ATG4D Recombinant Protein Antigen (NBP2-49525PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG4D Recombinant Protein Antigen (NBP2-49525PEP) (0)

There are no reviews for ATG4D Recombinant Protein Antigen (NBP2-49525PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATG4D Recombinant Protein Antigen (NBP2-49525PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG4D Products

Array NBP2-49525PEP

Research Areas for ATG4D Recombinant Protein Antigen (NBP2-49525PEP)

Find related products by research area.

Blogs on ATG4D.

ATG4D - A regulator of autophagy and apoptosis
Autophagy is an essential cellular process whereby damaged proteins and organelles are degraded and recycled. Autophagy, while happening constantly at a basal level, is tightly regulated and can be further induced under cellular stress. One of the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATG4D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG4D