ATG4D Antibody [DyLight 650]

Product Discontinued

ATG4D Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human ATG4D (NP_116274.3).
  
  Sequence:
  MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPDEVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRLWLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELSGSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATG4D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for ATG4D Antibody [DyLight 650]

• APG4 autophagy 4 homolog D (S. cerevisiae)
• APG4 autophagy 4 homolog D
• APG4D
• APG4-D
• ATG4 autophagy related 4 homolog D (S. cerevisiae)
• AUTL4
• AUT-like 4 cysteine endopeptidase
• AUT-like 4, cysteine endopeptidase (S. cerevisiae)
• AUT-like 4, cysteine endopeptidase
• autophagin-4
• Autophagy-related cysteine endopeptidase 4
• Autophagy-related protein 4 homolog D
• cysteine protease ATG4D
• cysteine protease involved in autophagy
• EC 3.4.22
• EC 3.4.22.-

Background

ATG4D is a gene that codes for a protein expressed in the skeletal muscle and testis and is 474 amino acids long with a weight of approximately 53 kDa. ATG4D is a cysteine protease required for autophagy. ATG4D has been shown to have interactions with TAF12, CASP3, CASP8, GABARAP, and UBC in pathways such as the regulation of autophagy pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATG4D