ATG4D Antibody [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related ATG4D Primary Antibodies

Order Details


    • Catalog Number
      NBP3-37970AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATG4D Antibody [Alexa Fluor® 488] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human ATG4D (NP_116274.3).

Sequence:
MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPDEVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRLWLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELSGSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG4D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for ATG4D Antibody [Alexa Fluor® 488]

  • APG4 autophagy 4 homolog D (S. cerevisiae)
  • APG4 autophagy 4 homolog D
  • APG4D
  • APG4-D
  • ATG4 autophagy related 4 homolog D (S. cerevisiae)
  • AUTL4
  • AUT-like 4 cysteine endopeptidase
  • AUT-like 4, cysteine endopeptidase (S. cerevisiae)
  • AUT-like 4, cysteine endopeptidase
  • autophagin-4
  • Autophagy-related cysteine endopeptidase 4
  • Autophagy-related protein 4 homolog D
  • cysteine protease ATG4D
  • cysteine protease involved in autophagy
  • EC 3.4.22
  • EC 3.4.22.-

Background

ATG4D is a gene that codes for a protein expressed in the skeletal muscle and testis and is 474 amino acids long with a weight of approximately 53 kDa. ATG4D is a cysteine protease required for autophagy. ATG4D has been shown to have interactions with TAF12, CASP3, CASP8, GABARAP, and UBC in pathways such as the regulation of autophagy pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-55202
Species: Hu
Applications: IHC,  IHC-P, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NBP2-24709
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB4324
Species: Hu, Mu
Applications: ICC, IP, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NBP2-15501
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-61690
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NB110-60928
Species: Al, Bv, Ca, Hu, Mu, Pm, Rt
Applications: EM, IHC,  IHC-P, WB
NBP1-76845
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
NBP3-32059
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB

Publications for ATG4D Antibody (NBP3-37970AF488) (0)

There are no publications for ATG4D Antibody (NBP3-37970AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG4D Antibody (NBP3-37970AF488) (0)

There are no reviews for ATG4D Antibody (NBP3-37970AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATG4D Antibody (NBP3-37970AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG4D Products

Array NBP3-37970AF488

Research Areas for ATG4D Antibody (NBP3-37970AF488)

Find related products by research area.

Blogs on ATG4D.

ATG4D - A regulator of autophagy and apoptosis
Autophagy is an essential cellular process whereby damaged proteins and organelles are degraded and recycled. Autophagy, while happening constantly at a basal level, is tightly regulated and can be further induced under cellular stress. One of the ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG4D Antibody [Alexa Fluor® 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG4D