ATF7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATF7 Antibody [NBP1-88876] - Staining of human cell line A-431 shows positivity in nucleus and cytoplasm.
Immunohistochemistry-Paraffin: ATF7 Antibody [NBP1-88876] - Staining of human cervix, uterine shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATF7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATF7 Protein (NBP1-88876PEP)
Publications
Read Publication using NBP1-88876.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25545367)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATF7 Antibody

  • activating transcription factor 7ATFATranscription factor ATF-A
  • cAMP-dependent transcription factor ATF-7
  • cyclic AMP-dependent transcription factor ATF-7
  • MGC57182

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-80703
Species: Hu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4256
Species: Hu
Applications: WB
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87224
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88876
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ATF7 Antibody (NBP1-88876)(1)

Reviews for ATF7 Antibody (NBP1-88876) (0)

There are no reviews for ATF7 Antibody (NBP1-88876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATF7 Antibody (NBP1-88876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF7 Products

Bioinformatics Tool for ATF7 Antibody (NBP1-88876)

Discover related pathways, diseases and genes to ATF7 Antibody (NBP1-88876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF7 Antibody (NBP1-88876)

Discover more about diseases related to ATF7 Antibody (NBP1-88876).
 

Pathways for ATF7 Antibody (NBP1-88876)

View related products by pathway.

PTMs for ATF7 Antibody (NBP1-88876)

Learn more about PTMs related to ATF7 Antibody (NBP1-88876).

Blogs on ATF7

There are no specific blogs for ATF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF7