ATF6 beta Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ATF6 beta. Peptide sequence: FNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ATF6B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ATF6 beta Antibody - BSA Free
Background
ATF-6 is a member of the basic-leucine zipper family of transcription factors. Endoplasmic reticulum stress causes cleavage of transmembrane ATF-6 and transclocation of active ATF-6 to the nucleus. Soluble ATF-6 can exist as either an ATF-6beta homodimer or an ATF-6alpha/beta heterodimer. Binding of the ATF-6beta homodimer or ATF-6alpha/beta heterodimer to the nuclear transcription factor Y C (NF-YC) induces ER chaperone transcription. Human ATF-6beta maps to 1q22-q23 gene locus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Publications for ATF6 beta Antibody (NBP2-84474) (0)
There are no publications for ATF6 beta Antibody (NBP2-84474).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ATF6 beta Antibody (NBP2-84474) (0)
There are no reviews for ATF6 beta Antibody (NBP2-84474).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ATF6 beta Antibody (NBP2-84474) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Additional ATF6 beta Products
Blogs on ATF6 beta