ATF6 beta Antibody

Images

 
Western Blot: ATF6 beta Antibody [NBP2-84474] - WB Suggested Anti-CREBL1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Muscle

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATF6 beta Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATF6 beta. Peptide sequence: FNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ATF6B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Control
HeLa DTT Treated / Untreated Cell Lysate

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATF6 beta Antibody

  • activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta
  • ATF6-beta
  • cAMP response element-binding protein-related protein
  • cAMP responsive element binding protein-like 1
  • CREBL1CREB-RP
  • Creb-related protein
  • Creb-rp
  • cyclic AMP-dependent transcription factor ATF-6 beta
  • FLJ10066
  • G13cAMP-responsive element-binding protein-like 1
  • Protein G13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-84308
Species: Hu
Applications: IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84010
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00221527-B01P
Species: Hu
Applications: ICC/IF, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
H00010181-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for ATF6 beta Antibody (NBP2-84474) (0)

There are no publications for ATF6 beta Antibody (NBP2-84474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF6 beta Antibody (NBP2-84474) (0)

There are no reviews for ATF6 beta Antibody (NBP2-84474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF6 beta Antibody (NBP2-84474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional ATF6 beta Products

Bioinformatics Tool for ATF6 beta Antibody (NBP2-84474)

Discover related pathways, diseases and genes to ATF6 beta Antibody (NBP2-84474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF6 beta Antibody (NBP2-84474)

Discover more about diseases related to ATF6 beta Antibody (NBP2-84474).
 

Pathways for ATF6 beta Antibody (NBP2-84474)

View related products by pathway.

PTMs for ATF6 beta Antibody (NBP2-84474)

Learn more about PTMs related to ATF6 beta Antibody (NBP2-84474).

Blogs on ATF6 beta

There are no specific blogs for ATF6 beta, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF6 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF6B