Recombinant Human ATE1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ATE1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-87 of Human ATE1

Source: Wheat Germ

Amino Acid Sequence: MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATE1 Protein

  • Arginine-tRNA--protein transferase 1
  • arginyltransferase 1MGC26724
  • arginyl-tRNA--protein transferase 1
  • arginyl-tRNA-protein transferase
  • EC 2.3.2.8
  • R-transferase 1

Background

ATE1 - arginyltransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-86253
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85001
Species: Hu
Applications: IHC, IHC-P
NBP2-65585
Species: Hu
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92388
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ATE1 Partial Recombinant Protein (H00011101-Q01) (0)

There are no publications for ATE1 Partial Recombinant Protein (H00011101-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATE1 Partial Recombinant Protein (H00011101-Q01) (0)

There are no reviews for ATE1 Partial Recombinant Protein (H00011101-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATE1 Partial Recombinant Protein (H00011101-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATE1 Products

Bioinformatics Tool for ATE1 Partial Recombinant Protein (H00011101-Q01)

Discover related pathways, diseases and genes to ATE1 Partial Recombinant Protein (H00011101-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATE1 Partial Recombinant Protein (H00011101-Q01)

Discover more about diseases related to ATE1 Partial Recombinant Protein (H00011101-Q01).
 

Pathways for ATE1 Partial Recombinant Protein (H00011101-Q01)

View related products by pathway.

PTMs for ATE1 Partial Recombinant Protein (H00011101-Q01)

Learn more about PTMs related to ATE1 Partial Recombinant Protein (H00011101-Q01).

Blogs on ATE1

There are no specific blogs for ATE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATE1 Antibody
NBP1-85872

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATE1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATE1