ATAT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human testis show strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ATAT1 Antibody [NBP2-48990] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATAT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDR
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATAT1 Recombinant Protein Antigen (NBP2-48990PEP)

Reactivity Notes

Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATAT1 Antibody

  • Acetyltransferase MEC-17
  • alpha tubulin acetyltransferase 1
  • alpha-TAT
  • alpha-tubulin N-acetyltransferase
  • C6orf134
  • chromosome 6 open reading frame 134
  • DKFZp547J097
  • EC 2.3.1.108
  • Em:AB023049.7
  • FLJ13158
  • MEC17Nbla00487
  • TAT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76966
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
DSE100
Species: Hu
Applications: ELISA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-05509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67811
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-48990
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for ATAT1 Antibody (NBP2-48990) (0)

There are no publications for ATAT1 Antibody (NBP2-48990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATAT1 Antibody (NBP2-48990) (0)

There are no reviews for ATAT1 Antibody (NBP2-48990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATAT1 Antibody (NBP2-48990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATAT1 Products

Bioinformatics Tool for ATAT1 Antibody (NBP2-48990)

Discover related pathways, diseases and genes to ATAT1 Antibody (NBP2-48990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ATAT1

There are no specific blogs for ATAT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATAT1