Recombinant Human ASXL1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ASXL1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 84 of Human ASXL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ASXL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ASXL1 GST (N-Term) Protein

  • additional sex combs like 1 (Drosophila)

Background

In Drosophila, the Additional sex combs (Asx) gene encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. Although the function of the protein encoded by this gene is not known, it does show some sequence similarity to the protein encoded by the Drosophila Asx gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MEP00B
Species: Mu
Applications: ELISA
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
AF5129
Species: Hu
Applications: WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MCS00
Species: Mu
Applications: ELISA
MCS00
Species: Mu
Applications: ELISA
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7954-GM/CF
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-32104
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-80739
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, IHC-P, WB
7954-GM/CF
Species: Hu
Applications: BA
203-IL/CF
Species: Hu
Applications: BA
H00171023-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ASXL1 Recombinant Protein (H00171023-P01) (0)

There are no publications for ASXL1 Recombinant Protein (H00171023-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASXL1 Recombinant Protein (H00171023-P01) (0)

There are no reviews for ASXL1 Recombinant Protein (H00171023-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASXL1 Recombinant Protein (H00171023-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASXL1 Products

Bioinformatics Tool for ASXL1 Recombinant Protein (H00171023-P01)

Discover related pathways, diseases and genes to ASXL1 Recombinant Protein (H00171023-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASXL1 Recombinant Protein (H00171023-P01)

Discover more about diseases related to ASXL1 Recombinant Protein (H00171023-P01).
 

Pathways for ASXL1 Recombinant Protein (H00171023-P01)

View related products by pathway.

PTMs for ASXL1 Recombinant Protein (H00171023-P01)

Learn more about PTMs related to ASXL1 Recombinant Protein (H00171023-P01).
 

Research Areas for ASXL1 Recombinant Protein (H00171023-P01)

Find related products by research area.

Blogs on ASXL1.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ASXL1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ASXL1