Recombinant Human ASXL1 GST (N-Term) Protein Summary
Description |
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 84 of Human ASXL1 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Full Length Recombinant Protein |
Gene |
ASXL1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
35.9 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human ASXL1 GST (N-Term) Protein
Background
In Drosophila, the Additional sex combs (Asx) gene encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. Although the function of the protein encoded by this gene is not known, it does show some sequence similarity to the protein encoded by the Drosophila Asx gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, PA, AP
Publications for ASXL1 Recombinant Protein (H00171023-P01) (0)
There are no publications for ASXL1 Recombinant Protein (H00171023-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ASXL1 Recombinant Protein (H00171023-P01) (0)
There are no reviews for ASXL1 Recombinant Protein (H00171023-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ASXL1 Recombinant Protein (H00171023-P01) (0)
Additional ASXL1 Products
Bioinformatics Tool for ASXL1 Recombinant Protein (H00171023-P01)
Discover related pathways, diseases and genes to ASXL1 Recombinant Protein (H00171023-P01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ASXL1 Recombinant Protein (H00171023-P01)
Discover more about diseases related to ASXL1 Recombinant Protein (H00171023-P01).
| | Pathways for ASXL1 Recombinant Protein (H00171023-P01)
View related products by pathway.
|
PTMs for ASXL1 Recombinant Protein (H00171023-P01)
Learn more about PTMs related to ASXL1 Recombinant Protein (H00171023-P01).
| | Research Areas for ASXL1 Recombinant Protein (H00171023-P01)
Find related products by research area.
|
Blogs on ASXL1.
The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence. Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation. Gene silencing in DNA ... Read full blog post.
|