ASTN2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ASTN2 Antibody [NBP1-82980] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ASTN2 Antibody [NBP1-82980] - Staining of human small intestine shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASTN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSKFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHYGSHY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASTN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASTN2 Protein (NBP1-82980PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASTN2 Antibody

  • astrotactin 2
  • bA264C15.1
  • bA67K19.1
  • KIAA0634astrotactin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2487
Species: Hu
Applications: WB, IP
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-56338
Species: Hu
Applications: ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF4524
Species: Rt
Applications: WB
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-94029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001501-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
NBP1-82980
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ASTN2 Antibody (NBP1-82980) (0)

There are no publications for ASTN2 Antibody (NBP1-82980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASTN2 Antibody (NBP1-82980) (0)

There are no reviews for ASTN2 Antibody (NBP1-82980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASTN2 Antibody (NBP1-82980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASTN2 Products

Bioinformatics Tool for ASTN2 Antibody (NBP1-82980)

Discover related pathways, diseases and genes to ASTN2 Antibody (NBP1-82980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASTN2 Antibody (NBP1-82980)

Discover more about diseases related to ASTN2 Antibody (NBP1-82980).
 

Pathways for ASTN2 Antibody (NBP1-82980)

View related products by pathway.

PTMs for ASTN2 Antibody (NBP1-82980)

Learn more about PTMs related to ASTN2 Antibody (NBP1-82980).

Blogs on ASTN2

There are no specific blogs for ASTN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASTN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASTN2