Aspartate beta hydroxylase Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Aspartate beta hydroxylase Antibody [NBP2-58045] - Staining of human cell line HeLa shows localization to endoplasmic reticulum.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aspartate beta hydroxylase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aspartate beta hydroxylase Antibody - BSA Free (NBP2-58045) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDE
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASPH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aspartate beta hydroxylase Recombinant Protein Antigen (NBP2-58045PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aspartate beta hydroxylase Antibody - BSA Free

• AAH
• ASP beta-hydroxylase
• aspartate beta-hydroxylaseA beta H-J-J
• aspartyl/asparaginyl-beta-hydroxylase
• BAH
• cardiac junctin
• CASQ2BP1
• EC 1.14.11.16
• HAAHaspartyl/asparaginyl beta-hydroxylase
• humbug
• JCTN
• junctate
• junctin
• Peptide-aspartate beta-dioxygenase

Background

Aspartate beta hydroxylase is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASPH