ASCL3 Antibody

Images

 
Immunohistochemistry-Paraffin: ASCL3 Antibody [NBP1-88635] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASCL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASCL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASCL3 Protein (NBP1-88635PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASCL3 Antibody

  • achaete-scute complex homolog 3 (Drosophila)
  • ASH-3
  • bHLH transcription factor Sgn-1 (Salivary Glands 1)
  • bHLH transcriptional regulator Sgn-1
  • BHLHA42
  • bHLHa42achaete-scute homolog 3
  • Class A basic helix-loop-helix protein 42
  • hASH3
  • HASH3achaete-scute complex (Drosophila) homolog-like 3
  • Sgn1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-22478
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-90762
Species: Hu
Applications: IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46420
Species: Hu
Applications: WB, IHC
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-88635
Species: Hu
Applications: IHC, IHC-P

Publications for ASCL3 Antibody (NBP1-88635) (0)

There are no publications for ASCL3 Antibody (NBP1-88635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL3 Antibody (NBP1-88635) (0)

There are no reviews for ASCL3 Antibody (NBP1-88635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ASCL3 Antibody (NBP1-88635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASCL3 Products

Bioinformatics Tool for ASCL3 Antibody (NBP1-88635)

Discover related pathways, diseases and genes to ASCL3 Antibody (NBP1-88635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL3 Antibody (NBP1-88635)

Discover more about diseases related to ASCL3 Antibody (NBP1-88635).
 

Pathways for ASCL3 Antibody (NBP1-88635)

View related products by pathway.

PTMs for ASCL3 Antibody (NBP1-88635)

Learn more about PTMs related to ASCL3 Antibody (NBP1-88635).

Blogs on ASCL3

There are no specific blogs for ASCL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASCL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASCL3