ASCL3 Antibody


Western Blot: ASCL3 Antibody [NBP1-69172] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ASCL3 Antibody Summary

Synthetic peptides corresponding to ASCL3 (achaete-scute complex homolog 3 (Drosophila)) The peptide sequence was selected from the C terminal of ASCL3. Peptide sequence PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ASCL3 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASCL3 Antibody

  • achaete-scute complex homolog 3 (Drosophila)
  • ASH-3
  • bHLH transcription factor Sgn-1 (Salivary Glands 1)
  • bHLH transcriptional regulator Sgn-1
  • BHLHA42
  • bHLHa42achaete-scute homolog 3
  • Class A basic helix-loop-helix protein 42
  • hASH3
  • HASH3achaete-scute complex (Drosophila) homolog-like 3
  • Sgn1


Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Po
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB

Publications for ASCL3 Antibody (NBP1-69172) (0)

There are no publications for ASCL3 Antibody (NBP1-69172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL3 Antibody (NBP1-69172) (0)

There are no reviews for ASCL3 Antibody (NBP1-69172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASCL3 Antibody (NBP1-69172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ASCL3 Products

Bioinformatics Tool for ASCL3 Antibody (NBP1-69172)

Discover related pathways, diseases and genes to ASCL3 Antibody (NBP1-69172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL3 Antibody (NBP1-69172)

Discover more about diseases related to ASCL3 Antibody (NBP1-69172).

Pathways for ASCL3 Antibody (NBP1-69172)

View related products by pathway.

PTMs for ASCL3 Antibody (NBP1-69172)

Learn more about PTMs related to ASCL3 Antibody (NBP1-69172).

Blogs on ASCL3

There are no specific blogs for ASCL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ASCL3 Antibody and receive a gift card or discount.


Gene Symbol ASCL3