We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ASAH1 Recombinant Protein Antigen

Images

 
There are currently no images for ASAH1 Protein (NBP1-89296PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ASAH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASAH1.

Source: E. coli

Amino Acid Sequence: ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASAH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89296.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASAH1 Recombinant Protein Antigen

  • ACDase
  • ACEC 3.5.1.23
  • Acid CDase
  • acid ceramidase
  • Acylsphingosine deacylase
  • ASAH
  • FLJ21558
  • FLJ22079
  • N-acylsphingosine amidohydrolase (acid ceramidase) 1
  • N-acylsphingosine amidohydrolase
  • PHP
  • PHP32N-acylsphingosine amidohydrolase (acid ceramidase)
  • Putative 32 kDa heart protein

Background

ASAH1 encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-95204
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-92684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-65676
Species: Hu
Applications: ELISA, IHC, IHC-Fr,  IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
AF2009
Species: Hu
Applications: ICC, IHC
202-IL
Species: Hu
Applications: BA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF7895
Species: Hu
Applications: IHC, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NB100-2614
Species: Hu
Applications: CyTOF-ready, Flow, IF, IHC, IP
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89296PEP
Species: Hu
Applications: AC

Publications for ASAH1 Protein (NBP1-89296PEP) (0)

There are no publications for ASAH1 Protein (NBP1-89296PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAH1 Protein (NBP1-89296PEP) (0)

There are no reviews for ASAH1 Protein (NBP1-89296PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ASAH1 Protein (NBP1-89296PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASAH1 Products

Blogs on ASAH1

There are no specific blogs for ASAH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASAH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASAH1