Recombinant Human ARPC4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARPC4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 28491 of Human ARPC4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF

Protein/Peptide Type
Recombinant Protein
Gene
ARPC4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARPC4 Protein

  • actin related protein 2/3 complex, subunit 4, 20kDa
  • actin-related protein 2/3 complex subunit 4
  • arp2/3 protein complex subunit p20
  • MGC13544
  • p20-Arc
  • subunit 4 (20 kD)

Background

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p20 subunit, has yet to be determined. Three transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1037
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP1-89016
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45504
Species: Hu
Applications: WB, IHC
NB100-2307
Species: Hu
Applications: WB
NBP2-34951
Species: Hu
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90114
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P

Publications for ARPC4 Recombinant Protein (H00010093-P01) (0)

There are no publications for ARPC4 Recombinant Protein (H00010093-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARPC4 Recombinant Protein (H00010093-P01) (0)

There are no reviews for ARPC4 Recombinant Protein (H00010093-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARPC4 Recombinant Protein (H00010093-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARPC4 Products

Bioinformatics Tool for ARPC4 Recombinant Protein (H00010093-P01)

Discover related pathways, diseases and genes to ARPC4 Recombinant Protein (H00010093-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARPC4 Recombinant Protein (H00010093-P01)

Discover more about diseases related to ARPC4 Recombinant Protein (H00010093-P01).
 

Pathways for ARPC4 Recombinant Protein (H00010093-P01)

View related products by pathway.

PTMs for ARPC4 Recombinant Protein (H00010093-P01)

Learn more about PTMs related to ARPC4 Recombinant Protein (H00010093-P01).
 

Research Areas for ARPC4 Recombinant Protein (H00010093-P01)

Find related products by research area.

Blogs on ARPC4

There are no specific blogs for ARPC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ARPC4 Antibody
NBP1-69003

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARPC4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARPC4