ARPC3 Antibody (2E11) - Azide and BSA Free

Western Blot: ARPC3 Antibody (2E11) [H00010094-M06] - Analysis of ARPC3 expression in transfected 293T cell line by ARPC3 monoclonal antibody (M06), clone 2E11. Lane 1: ARPC3 transfected lysatE (20.5 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: ARPC3 Antibody (2E11) [H00010094-M06] - Detection limit for recombinant GST tagged ARPC3 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ARPC3 Antibody (2E11) - Azide and BSA Free Summary

• Immunogen: ARPC3 (NP_005710.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISEC
• Specificity: ARPC3 - actin related protein 2/3 complex, subunit 3, 21kDa (2E11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ARPC3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARPC3 Antibody (2E11) - Azide and BSA Free

• actin related protein 2/3 complex, subunit 3, 21kDa
• subunit 3 (21 kD)

Background

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p21 subunit, has yet to be determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARPC3
• Entrez:
  • 10094(Human)
• Uniprot:
  • NP_005710(Human)