ARNT2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ARNT2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARNT2.
  
  

  Source: E. coli

  Amino Acid Sequence: GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ARNT2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88623.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARNT2 Recombinant Protein Antigen

• ARNT protein 2
• aryl-hydrocarbon receptor nuclear translocator 2
• bHLHe1BHLHE1
• Class E basic helix-loop-helix protein 1
• KIAA0307aryl hydrocarbon receptor nuclear translocator 2

Background

AhR, Arnt 1, Arnt 2 and BMAL1 are members of a family of transcription factors that contain a basic helix-loop-helix motif and a common "PAS" motif. The aromatic (aryl) hydrocarbon receptor, AhR, is a ligand dependent transcription factor that interacts with specific DNA sequences termed xenobiotic responsive elements (XREs) to activate several genes including CYP1A1, glutathione S-transferase Ya subunit and DT-diaphorase. The Ah receptor nuclear translocator proteins (Arnt 1 or Arnt 2) are required for ligand-dependent nuclear translocation of the Ah receptor and are also necessary for Ah receptor binding to the XRE element. BMAL1 (Brain and Muscle Arnt-like protein 1), also designated Arnt 3, TIC, JAP3 or MOP-3, has been shown to dimerize with Clock and bind to the promoter region of mPer1, suggesting that this protein plays a role in regulation of circadian oscillation in mammals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ARNT2