ARL8B Antibody


Western Blot: ARL8B Antibody [NBP1-56577] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ARL8B Antibody Summary

Synthetic peptides corresponding to ARL8B(ADP-ribosylation factor-like 8B) The peptide sequence was selected from the middle region of ARL8B. Peptide sequence SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARL8B and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARL8B Antibody

  • ADP-ribosylation factor-like 10C
  • ADP-ribosylation factor-like 8B
  • ADP-ribosylation factor-like protein 10C
  • ADP-ribosylation factor-like protein 8B
  • ARL10C
  • FLJ10702
  • Gie1
  • Novel small G protein indispensable for equal chromosome segregation 1


ARL8B may play a role in lysosome motility and chromosome segregation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Mk
Applications: WB, IF
Species: Hu
Applications: WB

Publications for ARL8B Antibody (NBP1-56577) (0)

There are no publications for ARL8B Antibody (NBP1-56577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL8B Antibody (NBP1-56577) (0)

There are no reviews for ARL8B Antibody (NBP1-56577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL8B Antibody (NBP1-56577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARL8B Products

Bioinformatics Tool for ARL8B Antibody (NBP1-56577)

Discover related pathways, diseases and genes to ARL8B Antibody (NBP1-56577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL8B Antibody (NBP1-56577)

Discover more about diseases related to ARL8B Antibody (NBP1-56577).

Pathways for ARL8B Antibody (NBP1-56577)

View related products by pathway.

PTMs for ARL8B Antibody (NBP1-56577)

Learn more about PTMs related to ARL8B Antibody (NBP1-56577).

Research Areas for ARL8B Antibody (NBP1-56577)

Find related products by research area.

Blogs on ARL8B

There are no specific blogs for ARL8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARL8B Antibody and receive a gift card or discount.


Gene Symbol ARL8B