ARL8B Antibody

Images

 
Western Blot: ARL8B Antibody [NBP1-56544] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL8B Antibody Summary

Immunogen
Synthetic peptides corresponding to ARL8B(ADP-ribosylation factor-like 8B) The peptide sequence was selected from the middle region of ARL8B (NP_060654). Peptide sequence DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL8B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARL8B and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARL8B Antibody

  • ADP-ribosylation factor-like 10C
  • ADP-ribosylation factor-like 8B
  • ADP-ribosylation factor-like protein 10C
  • ADP-ribosylation factor-like protein 8B
  • ARL10C
  • FLJ10702
  • Gie1
  • Novel small G protein indispensable for equal chromosome segregation 1

Background

ARL8B may play a role in lysosome motility and chromosome segregation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14316
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39010
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45795
Species: Hu
Applications: WB, IHC
NBP2-46016
Species: Hu, Mu, Ca, Mk
Applications: WB, IF
NBP1-56544
Species: Hu
Applications: WB

Publications for ARL8B Antibody (NBP1-56544) (0)

There are no publications for ARL8B Antibody (NBP1-56544).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL8B Antibody (NBP1-56544) (0)

There are no reviews for ARL8B Antibody (NBP1-56544). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL8B Antibody (NBP1-56544) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL8B Products

Bioinformatics Tool for ARL8B Antibody (NBP1-56544)

Discover related pathways, diseases and genes to ARL8B Antibody (NBP1-56544). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL8B Antibody (NBP1-56544)

Discover more about diseases related to ARL8B Antibody (NBP1-56544).
 

Pathways for ARL8B Antibody (NBP1-56544)

View related products by pathway.

PTMs for ARL8B Antibody (NBP1-56544)

Learn more about PTMs related to ARL8B Antibody (NBP1-56544).
 

Research Areas for ARL8B Antibody (NBP1-56544)

Find related products by research area.

Blogs on ARL8B

There are no specific blogs for ARL8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL8B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL8B
Entrez
Uniprot