ARL5A Antibody

Images

 
Immunohistochemistry-Paraffin: ARL5A Antibody [NBP1-88987] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL5A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARL5A Protein (NBP1-88987PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL5A Antibody

  • ADP-ribosylation factor-like 5
  • ADP-ribosylation factor-like 5A
  • ADP-ribosylation factor-like protein 5A
  • ARFLP5
  • ARL5ADP-ribosylation factor-like protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01669
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
H00009214-M01
Species: Hu
Applications: WB, ELISA, Flow
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49680
Species: Hu
Applications: WB, IHC
NB100-511
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5596
Species: Hu
Applications: WB, IHC, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
MAB5457
Species: Hu, Mu, Rt
Applications: WB
NBP2-45925
Species: Hu, Mu, Ca
Applications: WB, IF
NBP2-07079
Species: Hu
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56355
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ARL5A Antibody (NBP1-88987) (0)

There are no publications for ARL5A Antibody (NBP1-88987).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL5A Antibody (NBP1-88987) (0)

There are no reviews for ARL5A Antibody (NBP1-88987). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARL5A Antibody (NBP1-88987) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL5A Products

Bioinformatics Tool for ARL5A Antibody (NBP1-88987)

Discover related pathways, diseases and genes to ARL5A Antibody (NBP1-88987). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL5A Antibody (NBP1-88987)

Discover more about diseases related to ARL5A Antibody (NBP1-88987).
 

Pathways for ARL5A Antibody (NBP1-88987)

View related products by pathway.

Research Areas for ARL5A Antibody (NBP1-88987)

Find related products by research area.

Blogs on ARL5A

There are no specific blogs for ARL5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL5A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL5A
Entrez
Uniprot