Recombinant Human ARL4C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARL4C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-192 of Human ARL4C full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ARL4C
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARL4C Protein

  • ADP ribosylation factor-like protein 7
  • ADP-ribosylation factor-like 4C
  • ADP-ribosylation factor-like 7
  • ADP-ribosylation factor-like protein 4C
  • ADP-ribosylation factor-like protein 7
  • ADP-ribosylation factor-like protein LAK
  • ARL7
  • LAK

Background

ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
796-IC
Species: Mu
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ARL4C Recombinant Protein (H00010123-P01) (0)

There are no publications for ARL4C Recombinant Protein (H00010123-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL4C Recombinant Protein (H00010123-P01) (0)

There are no reviews for ARL4C Recombinant Protein (H00010123-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL4C Recombinant Protein (H00010123-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARL4C Products

Bioinformatics Tool for ARL4C Recombinant Protein (H00010123-P01)

Discover related pathways, diseases and genes to ARL4C Recombinant Protein (H00010123-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL4C Recombinant Protein (H00010123-P01)

Discover more about diseases related to ARL4C Recombinant Protein (H00010123-P01).
 

Pathways for ARL4C Recombinant Protein (H00010123-P01)

View related products by pathway.

PTMs for ARL4C Recombinant Protein (H00010123-P01)

Learn more about PTMs related to ARL4C Recombinant Protein (H00010123-P01).
 

Research Areas for ARL4C Recombinant Protein (H00010123-P01)

Find related products by research area.

Blogs on ARL4C

There are no specific blogs for ARL4C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARL4C Antibody
NBP1-88988
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARL4C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL4C