ARK5/NUAK1 Antibody

Immunocytochemistry/Immunofluorescence: ARK5/NUAK1 Antibody [NBP2-58038] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli fibrillar center & microtubules. Antibody staining is shown in green.

Product Discontinued

ARK5/NUAK1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUAK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARK5/NUAK1 Antibody

• AMPK-related protein kinase 5
• ARK5
• ARK5AMP-activated protein kinase family member 5
• EC 2.7.11
• EC 2.7.11.1
• KIAA0537NUAK family SNF1-like kinase 1
• NUAK family, SNF1-like kinase, 1
• NUAK1

Background

NUAK1 is involved in tolerance to glucose starvation. Phosphorylates ATM. Suppresses Fas-induced apoptosis by phosphorylation of CASP6, thus suppressing the activation of the caspase and the subsequent cleavage of CFLAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUAK1