ARK5/NUAK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARK5/NUAK1 Antibody [NBP2-58038] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli fibrillar center & microtubules. Antibody staining is shown in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARK5/NUAK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAE
Specificity
Specificity of human ARK5/NUAK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUAK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARK5/NUAK1 Recombinant Protein Antigen (NBP2-58038PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ARK5/NUAK1 Antibody

  • AMPK-related protein kinase 5
  • ARK5
  • ARK5AMP-activated protein kinase family member 5
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0537NUAK family SNF1-like kinase 1
  • NUAK family, SNF1-like kinase, 1
  • NUAK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-81880
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67415
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00008837-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF4820
Species: Hu
Applications: WB, IHC
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56114
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MMP200
Species: Hu, Mu, Rt, Po, Ca
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP2-45755
Species: Hu
Applications: WB, IHC
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP2-58038
Species: Hu
Applications: ICC/IF

Publications for ARK5/NUAK1 Antibody (NBP2-58038) (0)

There are no publications for ARK5/NUAK1 Antibody (NBP2-58038).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARK5/NUAK1 Antibody (NBP2-58038) (0)

There are no reviews for ARK5/NUAK1 Antibody (NBP2-58038). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARK5/NUAK1 Antibody (NBP2-58038) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARK5/NUAK1 Products

Bioinformatics Tool for ARK5/NUAK1 Antibody (NBP2-58038)

Discover related pathways, diseases and genes to ARK5/NUAK1 Antibody (NBP2-58038). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARK5/NUAK1 Antibody (NBP2-58038)

Discover more about diseases related to ARK5/NUAK1 Antibody (NBP2-58038).
 

Pathways for ARK5/NUAK1 Antibody (NBP2-58038)

View related products by pathway.

PTMs for ARK5/NUAK1 Antibody (NBP2-58038)

Learn more about PTMs related to ARK5/NUAK1 Antibody (NBP2-58038).
 

Research Areas for ARK5/NUAK1 Antibody (NBP2-58038)

Find related products by research area.

Blogs on ARK5/NUAK1

There are no specific blogs for ARK5/NUAK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARK5/NUAK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUAK1