ARID1A Recombinant Protein Antigen

Images

 
There are currently no images for ARID1A Protein (NBP1-88932PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ARID1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARID1A.

Source: E.coli

Amino Acid Sequence: PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARID1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88932.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ARID1A Recombinant Protein Antigen

  • ARID domain-containing protein 1A
  • AT rich interactive domain 1A (SWI- like)
  • AT rich interactive domain 1A (SWI-like)
  • AT-rich interactive domain-containing protein 1A
  • B120SWI-like protein
  • BAF250a
  • BAF250SWI/SNF complex protein p270
  • BM029
  • brain protein 120
  • BRG1-associated factor 250
  • BRG1-associated factor 250a
  • C10rf4
  • C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1
  • chromatin remodeling factor p250
  • hELD
  • hOSA1
  • matrix associated, actin dependent regulator of chromatin
  • Osa homolog 1
  • OSA1 nuclear protein
  • OSA1
  • P270
  • SMARCF1
  • subfamily f, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for ARID1A Protein (NBP1-88932PEP) (0)

There are no publications for ARID1A Protein (NBP1-88932PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARID1A Protein (NBP1-88932PEP) (0)

There are no reviews for ARID1A Protein (NBP1-88932PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ARID1A Protein (NBP1-88932PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARID1A Products

Bioinformatics Tool for ARID1A Protein (NBP1-88932PEP)

Discover related pathways, diseases and genes to ARID1A Protein (NBP1-88932PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID1A Protein (NBP1-88932PEP)

Discover more about diseases related to ARID1A Protein (NBP1-88932PEP).
 

Pathways for ARID1A Protein (NBP1-88932PEP)

View related products by pathway.

PTMs for ARID1A Protein (NBP1-88932PEP)

Learn more about PTMs related to ARID1A Protein (NBP1-88932PEP).
 

Research Areas for ARID1A Protein (NBP1-88932PEP)

Find related products by research area.

Blogs on ARID1A

There are no specific blogs for ARID1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
ARID1A Antibody
NBP1-88932

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARID1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID1A