ARHGAP25 Antibody - BSA Free

Western Blot: ARHGAP25 Antibody [NBP2-57228] - Analysis using Anti-ARHGAP25 antibody NBP2-57228 (A) shows similar pattern to independent antibody NBP1-83053 (B).

Immunocytochemistry/Immunofluorescence: ARHGAP25 Antibody [NBP2-57228] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human kidney.

Western Blot: ARHGAP25 Antibody [NBP2-57228] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human spleen shows high expression.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining in human spleen and cerebral cortex tissues using anti-ARHGAP25 antibody. Corresponding ARHGAP25 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-ARHGAP25 antibody NBP2-57228 (A) shows similar protein distribution across tissues to independent antibody NBP1-83053 (B).

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human colon.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human lymph node.

Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex using Anti-ARHGAP25 antibody NBP2-57228.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP25 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGAP25 Antibody - BSA Free (NBP2-57228) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPC
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP25
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARHGAP25 Recombinant Protein Antigen (NBP2-57228PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARHGAP25 Antibody - BSA Free

• KAIA0053
• KIAA0053
• Rho GTPase activating protein 25
• rho GTPase-activating protein 25
• Rho-type GTPase-activating protein 25

Background

ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP25