ARHGAP25 Antibody

Images

 
Independent Antibodies: Western Blot: ARHGAP25 Antibody [NBP2-57228] - Analysis using Anti-ARHGAP25 antibody NBP2-57228 (A) shows similar pattern to independent antibody NBP1-83053 (B).
Immunocytochemistry/ Immunofluorescence: ARHGAP25 Antibody [NBP2-57228] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human lymph node.
Western Blot: ARHGAP25 Antibody [NBP2-57228] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human spleen shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining in human spleen and cerebral cortex tissues using anti-ARHGAP25 antibody. Corresponding ARHGAP25 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-ARHGAP25 antibody NBP2-57228 (A) shows similar ...read more
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human colon.
Immunohistochemistry-Paraffin: ARHGAP25 Antibody [NBP2-57228] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP25 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPC
Specificity
Specificity of human ARHGAP25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP25
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ARHGAP25 Antibody

  • KAIA0053
  • KIAA0053
  • Rho GTPase activating protein 25
  • rho GTPase-activating protein 25
  • Rho-type GTPase-activating protein 25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44073
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83870
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP1-89732
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-15452
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57228
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGAP25 Antibody (NBP2-57228) (0)

There are no publications for ARHGAP25 Antibody (NBP2-57228).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP25 Antibody (NBP2-57228) (0)

There are no reviews for ARHGAP25 Antibody (NBP2-57228). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGAP25 Antibody (NBP2-57228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGAP25 Products

Bioinformatics Tool for ARHGAP25 Antibody (NBP2-57228)

Discover related pathways, diseases and genes to ARHGAP25 Antibody (NBP2-57228). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP25 Antibody (NBP2-57228)

Discover more about diseases related to ARHGAP25 Antibody (NBP2-57228).
 

Pathways for ARHGAP25 Antibody (NBP2-57228)

View related products by pathway.

PTMs for ARHGAP25 Antibody (NBP2-57228)

Learn more about PTMs related to ARHGAP25 Antibody (NBP2-57228).

Blogs on ARHGAP25

There are no specific blogs for ARHGAP25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP25