ARHGAP18 Antibody

Images

 
Western Blot: ARHGAP18 Antibody [NBP2-82653] - Host: Rabbit. Target Name: ARHGAP18. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP18 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP18. Peptide sequence: QALNQKESSKEKIQKSKGDDATLPSFRLPKDKTGTTRIGDLAPQDMKKVC The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP18 Antibody

  • bA307O14.2
  • MacGAP
  • MGC126757
  • Rho GTPase activating protein 18
  • rho-type GTPase-activating protein 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
DGD150
Species: Hu
Applications: ELISA
NBP2-23485
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00057522-M03
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-88831
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-83870
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBL1-10259
Species: Hu
Applications: WB
NBP2-38235
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-36945
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB
NBP1-33197
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-15454
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-57680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: IHC, IHC-P, WB

Publications for ARHGAP18 Antibody (NBP2-82653) (0)

There are no publications for ARHGAP18 Antibody (NBP2-82653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP18 Antibody (NBP2-82653) (0)

There are no reviews for ARHGAP18 Antibody (NBP2-82653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP18 Antibody (NBP2-82653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGAP18 Products

Bioinformatics Tool for ARHGAP18 Antibody (NBP2-82653)

Discover related pathways, diseases and genes to ARHGAP18 Antibody (NBP2-82653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP18 Antibody (NBP2-82653)

Discover more about diseases related to ARHGAP18 Antibody (NBP2-82653).
 

Pathways for ARHGAP18 Antibody (NBP2-82653)

View related products by pathway.

PTMs for ARHGAP18 Antibody (NBP2-82653)

Learn more about PTMs related to ARHGAP18 Antibody (NBP2-82653).

Blogs on ARHGAP18

There are no specific blogs for ARHGAP18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP18