Argonaute 4 Antibody

Images

 
Western Blot: Argonaute 4 Antibody [NBP1-55239] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Argonaute 4 Antibody Summary

Immunogen
Synthetic peptides corresponding to EIF2C4(eukaryotic translation initiation factor 2C, 4) The peptide sequence was selected from the middle region of EIF2C4 (NP_060099). Peptide sequence: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF2C4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against EIF2C4 and was validated on Western blot.
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Argonaute 4 Antibody

  • AGO4argonaute 4
  • Argonaute4
  • eIF2C 4
  • eIF-2C 4
  • Eukaryotic translation initiation factor 2C 4
  • eukaryotic translation initiation factor 2C, 4
  • FLJ20033
  • hAgo4
  • KIAA1567argonaute4
  • protein argonaute-4

Background

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene i

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-71691
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF6548
Species: Hu, Mu
Applications: IHC
NB110-60017
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-FrFl
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45626
Species: Hu
Applications: WB, IHC
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP1-22987
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-80690
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6367
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP

Publications for Argonaute 4 Antibody (NBP1-55239) (0)

There are no publications for Argonaute 4 Antibody (NBP1-55239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Argonaute 4 Antibody (NBP1-55239) (0)

There are no reviews for Argonaute 4 Antibody (NBP1-55239). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argonaute 4 Antibody (NBP1-55239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Argonaute 4 Antibody (NBP1-55239)

Discover related pathways, diseases and genes to Argonaute 4 Antibody (NBP1-55239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argonaute 4 Antibody (NBP1-55239)

Discover more about diseases related to Argonaute 4 Antibody (NBP1-55239).
 

Pathways for Argonaute 4 Antibody (NBP1-55239)

View related products by pathway.

PTMs for Argonaute 4 Antibody (NBP1-55239)

Learn more about PTMs related to Argonaute 4 Antibody (NBP1-55239).

Blogs on Argonaute 4

There are no specific blogs for Argonaute 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Argonaute 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2C4
Entrez
Uniprot