ARFIP2 Antibody - BSA Free

Staining of human cell line MCF-7 shows localization to nucleoli & the Golgi apparatus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARFIP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARFIP2 Antibody - BSA Free (NBP3-25281) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ARFIP2 using the following amino acid sequence: GSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRT
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARFIP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARFIP2 Antibody - BSA Free

• ADP-ribosylation factor interacting protein 2
• ADP-ribosylation factor-interacting protein 2
• arfaptin 2
• arfaptin-2
• Partner of RAC1
• POR1partner of RAC1 (arfaptin 2)
• Protein POR1

Background

Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARFIP2