ARFGAP1 Antibody

Images

 
Western Blot: ARFGAP1 Antibody [NBP2-14305] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: ARFGAP1 Antibody [NBP2-14305] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane, cytosol, the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: ARFGAP1 Antibody [NBP2-14305] - Staining of human stomach, lower shows moderate cytoplasmic and nuclear membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARFGAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSSDSWEV WGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARFGAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
ARFGAP1 Recombinant Protein Antigen (NBP2-14305PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARFGAP1 Antibody

  • ADP-ribosylation factor 1 GTPase activating protein
  • ADP-ribosylation factor 1 GTPase-activating protein
  • ADP-ribosylation factor GTPase activating protein 1
  • ADP-ribosylation factor GTPase-activating protein 1
  • ARF GAP 1
  • ARF1 GAP
  • ARF1-directed GTPase-activating protein
  • ARF1GAP
  • bA261N11.3
  • FLJ10767
  • GAP protein
  • HRIHFB2281
  • MGC39924

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88842
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-84534
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-83687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-14305
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARFGAP1 Antibody (NBP2-14305) (0)

There are no publications for ARFGAP1 Antibody (NBP2-14305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARFGAP1 Antibody (NBP2-14305) (0)

There are no reviews for ARFGAP1 Antibody (NBP2-14305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARFGAP1 Antibody (NBP2-14305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARFGAP1 Products

Bioinformatics Tool for ARFGAP1 Antibody (NBP2-14305)

Discover related pathways, diseases and genes to ARFGAP1 Antibody (NBP2-14305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFGAP1 Antibody (NBP2-14305)

Discover more about diseases related to ARFGAP1 Antibody (NBP2-14305).
 

Pathways for ARFGAP1 Antibody (NBP2-14305)

View related products by pathway.

PTMs for ARFGAP1 Antibody (NBP2-14305)

Learn more about PTMs related to ARFGAP1 Antibody (NBP2-14305).

Blogs on ARFGAP1

There are no specific blogs for ARFGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFGAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARFGAP1